(data stored in ACNUC7421 zone)

EMBL: CP001389.PE196

CP001389.PE196       Location/Qualifiers
FT   CDS_pept        225260..225667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24000"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU9"
FT                   /protein_id="ACP24000.1"
FT                   /translation="MDLLGGGSRNMQASRLLAVLWLFCASFAMQVITVGQSVSSRVGAQ
FT                   GGNVSAPDGGSPDRPAARQVSRAVALPELRIVGERPDGKSTLGGDPVAILAAEAATLPI
FT                   YEDIRPLFFTRTEVAVGSRHDSERIRGPPAV"
     atggacctcc tgggtggtgg cagcagaaac atgcaggcca gccggctcct tgccgtgctg        60
     tggctgttct gtgcttcctt tgccatgcag gtcatcaccg tcgggcagag cgtttcgagc       120
     cgtgtgggtg cgcagggcgg caatgtctcc gcacccgacg gcggatcacc cgatcgcccc       180
     gccgcgcgcc aggtttcccg cgccgtcgcc ttgccggaat tgcgcatcgt cggcgagcgg       240
     cccgacggaa agtcgacgct tggtggcgat cctgttgcga tcctcgcggc cgaagcggcg       300
     accttgccga tttatgagga cattcgcccc ctcttcttca cgcgcaccga agtcgcagtc       360
     ggctcccgtc acgatagcga gcggatccgc ggaccgcccg cggtctag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page