(data stored in ACNUC7421 zone)

EMBL: CP001389.PE20

CP001389.PE20        Location/Qualifiers
FT   CDS_pept        complement(18073..18792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00200"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23824"
FT                   /db_xref="GOA:C3MEK1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK1"
FT                   /protein_id="ACP23824.1"
FT                   /translation="MRILQISQEPNGTDGPLMLNQARYPDILADSGTSPADAYASAARH
FT                   SARVKRLKIVLPFAAGVIALVFAAISFVRAFLPEDLQLETATIENGKIVMQNPAISGRN
FT                   RQDISYSMKAQRALQDIANPDIITLEQIHAEMPVNDTLVATVDATSGIYDRGANTLDMN
FT                   APFTISMNNGVNADFQSAYLDIDAGEMETKHPIAISMNGGSIIAQSLRMTDKGRIVTFE
FT                   GMVRVNVEPSAIRKNAK"
     atgcggatct tgcagatatc gcaagaaccc aacggaaccg acgggccctt gatgctgaac        60
     caagcgcgct atcccgatat ccttgccgat tcgggtacga gccccgccga tgcctacgca       120
     tcggcggcgc ggcattccgc gcgggtgaag cgcctgaaga tcgtcttgcc gttcgcggcc       180
     ggcgtgatcg ccctcgtctt cgcagcgatt tccttcgtgc gcgcctttct gccggaggat       240
     ctgcaactcg aaaccgcaac gatcgaaaac ggcaagatcg tcatgcagaa tccggcgatt       300
     tccggccgca accggcagga catcagctat tccatgaagg cccagcgggc gctgcaggac       360
     atcgccaatc ccgacatcat cacgcttgag cagatccatg ccgagatgcc ggtcaacgat       420
     acgctggtcg ctacggtgga cgcgacaagc ggcatttacg atcgcggcgc aaatacgctc       480
     gacatgaacg ccccgttcac tatttctatg aataatggcg tcaatgccga tttccagtcg       540
     gcatatctgg atatcgacgc cggcgaaatg gaaaccaagc atccgattgc catcagcatg       600
     aacggcggat cgatcattgc gcagtcgctg cgaatgacag ataagggacg tattgtaaca       660
     ttcgaaggca tggtccgggt caatgtcgaa ccgagcgcca tccgcaagaa cgccaaatag       720
//

If you have problems or comments...

PBIL Back to PBIL home page