(data stored in ACNUC7421 zone)

EMBL: CP001389.PE202

CP001389.PE202       Location/Qualifiers
FT   CDS_pept        complement(231670..233289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02060"
FT                   /product="conserved hypothetical protein, contains
FT                   sulfatase protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24006"
FT                   /db_xref="GOA:C3MFV5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV5"
FT                   /protein_id="ACP24006.1"
FT                   /translation="MKLLKGIGLALLPIQLHDYPAPLTLGCYLLSCGVIFFTDRFALPA
FT                   RERRRNASPHGRNQDIIDVLARLPVIALVFAGFFAISWRPLYAAAGVMSFFIIFTGISR
FT                   AKFKFIREPLVFSDIALVADVFKYKSIFYATSLNIVFWIVAVLYVFGVSGLYMYFEPTV
FT                   LPARDKMFWILVMIGIAAGPWLSLFYGPVNRPTAALVQRLMGKKVNVKMSTVRFGTFGS
FT                   VVFHFIVWLGVKREKIVAELSERLRAAVHELIGHEDAPLIVVWQSESFIDMRHFGVDTI
FT                   KLPAIDRLRQQAVQWGRLSNVFEGGYTLRTEFAVLSGLVPDDIHVDASYPYLRASHYAD
FT                   VVWPGKLKRAGWRTHFIHPYDRTFFLRHKAMPVLGFDTLTMLDAFDHDPSQDGLYVSDA
FT                   VLTARVLEETQKLPDDESGLFFVASMANHGPWEPGRVEALTNPVEIYLAILQQSDAALK
FT                   KLVDGLDRLDRPVWLVFYGDHAPLLKSFADPFPDPRTDYFIVPLAKARPANQRPKPPQD
FT                   EDPWNLLRALLKHANLHKDALQ"
     gtgaaattgc tcaaaggtat cggcttggcg cttcttccca tccagttgca cgactatccg        60
     gcaccgttga cgctcggctg ctatctgctg tcctgcggcg tgatcttctt caccgatcga       120
     tttgccttgc cggcccgcga gcgccgaagg aacgcgtctc cccatggccg taatcaggac       180
     atcatcgacg tccttgccag gctgccggtg atagcgctcg tcttcgccgg ctttttcgca       240
     atctcctggc gaccgcttta cgcggctgcc ggggtcatga gcttcttcat catcttcacc       300
     ggcatttccc gtgcgaagtt caagttcatc cgcgagccac tggtcttctc cgacatcgcc       360
     ctcgtcgccg acgtgttcaa atacaagtcg atcttctacg cgacgtcgct gaacatcgtg       420
     ttctggatcg tcgccgtcct ctacgtcttc ggcgtctcgg gcctctacat gtatttcgag       480
     ccgacggtgc tgccggcacg cgacaagatg ttttggattc tggtgatgat cgggatcgcc       540
     gcaggaccct ggctctcgct gttctacggt ccggtcaacc gccccaccgc cgccctcgtg       600
     cagcgtctga tggggaagaa ggtcaacgtc aagatgagca cggtgcgctt cggcaccttc       660
     ggctcggtcg tcttccattt catcgtctgg ctgggggtca agcgcgagaa gatcgtcgcc       720
     gaactctccg aacgcctgcg cgccgccgtc catgagctga tcggccacga ggacgcgccg       780
     ctgatcgtcg tctggcaatc ggaatccttc atcgacatgc ggcatttcgg cgtggacacg       840
     atcaagctgc cggcgatcga caggctgcgc cagcaggcgg tgcaatgggg ccggctgagc       900
     aacgtcttcg aaggcggcta cacgctgcgc accgaattcg ccgtcctgag cggcctggtg       960
     ccggacgata tccatgtcga tgcgagctat ccctatcttc gcgcctccca ctatgccgat      1020
     gtcgtctggc cgggaaagtt gaagcgggcc ggctggcgca cccatttcat tcatccttat      1080
     gaccggacct tcttcctgcg ccacaaggcg atgccggtgt tgggcttcga cacgctgacc      1140
     atgctcgacg ccttcgacca tgatccgtcc caagatggtc tctacgtctc cgacgccgtg      1200
     ttgaccgcca gagttctgga agagacgcag aagctccccg acgacgaaag cgggctcttt      1260
     ttcgtggcct cgatggccaa tcacggtcct tgggagccgg gccgcgttga agcgctcacc      1320
     aatccggtcg agatctacct ggcgatcctt cagcaatcgg atgccgcact gaagaaactg      1380
     gtcgacggcc tggacagatt ggatcgcccc gtttggctcg tcttctacgg tgatcatgct      1440
     ccgctcctca aatcctttgc cgaccctttt cccgatccgc gcacggatta tttcatcgtc      1500
     ccgcttgcca aggcgcgccc ggcaaatcag cgtcccaaac caccgcagga cgaggacccg      1560
     tggaatcttc tgcgtgccct gctcaagcac gccaatctgc acaaggacgc gctgcaatag      1620
//

If you have problems or comments...

PBIL Back to PBIL home page