(data stored in ACNUC7421 zone)

EMBL: CP001389.PE203

CP001389.PE203       Location/Qualifiers
FT   CDS_pept        complement(233376..234179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02070"
FT                   /product="follicular variant translocation protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24007"
FT                   /db_xref="GOA:C3MFV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV6"
FT                   /protein_id="ACP24007.1"
FT                   /translation="MTHVIITGGSSGIGLALASLYASRGARLSLIARSRDLLELAAQTL
FT                   VSKYGARQGDIHIEAADVANEAKIGPAIGRCIEALGPCDILVTSAGIVEPAPFLDASSA
FT                   AFRRQMETNFSGTVHAVRAVYPDMVQRRSGHIVMISSGSGLIGIYGYTAYCASKFALRG
FT                   FAEALRSEARCHGVGVSVGYPPDTETPQFEREIAERPREASVVMGVVRPWSAEAVARKI
FT                   VDGIDRKRFEIYFGLTLFLLGRFGPAVRPLINWWFDRAIERSRGR"
     atgacccatg tgatcatcac cggcggctcg agcggcatcg gcctggcact cgcgtccctc        60
     tatgcaagcc gcggcgctcg gctgtcactg attgcgcgct cgcgcgatct cctggaactg       120
     gcggcgcaga cgcttgtctc caaatacggc gcgcggcaag gcgatatcca tatcgaagcc       180
     gccgatgtcg cgaacgaggc aaaaatcggc ccggcgatcg gccgctgcat cgaggcgctg       240
     ggcccctgcg atattctcgt gacgtccgca ggcattgtcg aaccggcgcc gttcctcgat       300
     gcgtcgagcg ccgccttccg tcgtcagatg gaaacgaact tctccggtac cgtgcacgcg       360
     gtgcgcgccg tctacccgga catggtgcag cggcgcagcg ggcatatcgt gatgatttcc       420
     tcgggtagcg gacttatcgg catatacggc tacacggcct attgcgcgtc gaaattcgcc       480
     ctgcgcggct ttgccgaagc gctgcgcagc gaagcgcgct gccacggcgt cggcgtatcg       540
     gtgggctatc cgccggatac cgaaacgccg caattcgagc gggaaatcgc agagcgcccg       600
     cgcgaggcaa gcgtggtgat gggcgtcgtc cgcccctgga gcgccgaggc cgttgcccgg       660
     aaaatcgtcg acggcatcga taggaaacgc ttcgagatct atttcggcct tacgcttttc       720
     ctgctcggcc gcttcggccc ggcggttcgg ccgctcatca actggtggtt cgaccgggcg       780
     atcgagcgca gccggggacg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page