(data stored in ACNUC7421 zone)

EMBL: CP001389.PE206

CP001389.PE206       Location/Qualifiers
FT   CDS_pept        243617..244840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02100"
FT                   /product="putative polysaccharide biosynthesis/export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24010"
FT                   /db_xref="GOA:C3MFV9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV9"
FT                   /protein_id="ACP24010.1"
FT                   /translation="MESSLCRIRSEVVKRVTALLLCTALAGCQAVPGEGPLTSDIVAEA
FT                   GQSGSQIGRKNATVFDIIDIDGQSARLVSEYVATTLSRRFGIGGGVGQVVIGVGDQLKV
FT                   TIFEAGSDGLFSTTESKQTSIDLVVQPDGKAAIPYVGSVRFAGLTLEQARQAILDALKQ
FT                   KAVEPDVIVTSTSTASRIVTVSGAVGRPSVVPLNLVSETINEVIAKAGGPSAQPYETYV
FT                   TLVRGKKTGTVLLKSIIESPSENIHVKQGDQIFVTRDPRTFTILGQVRANQRVEFGAND
FT                   LNLLEAVALAGGGADRTIDAKGYFVFRYEEPDIVMSLLGRERFNTMLSKGMQPDRVGRY
FT                   PIVYRFNMTNPDSLIVGQTFPIKNRDVIYASRHPSVDITKFMDFIARPIGIANSGVNIA
FT                   DNLDDLNN"
     atggaatcat cgctgtgccg aatacggagt gaagtagtga aacgagtgac tgcccttctg        60
     ctttgtaccg cgctagcggg gtgtcaggct gtaccgggcg aggggcctct gacaagcgat       120
     atcgtcgcag aagccggcca atcgggatcg cagatcggca ggaagaatgc caccgttttc       180
     gacatcatcg atattgacgg ccagtccgcg cggctcgttt ccgaatatgt ggcgacgacg       240
     ctgagccgcc gcttcggcat tggcggcggg gtcggccagg tggtgatcgg cgtcggcgac       300
     cagctgaagg tcaccatttt cgaggccggc agcgacggcc tgttttccac aacggaatcg       360
     aagcagacca gcatcgacct cgttgtccag ccggatggca aggcggcgat cccctatgtc       420
     ggctccgtcc gcttcgccgg cttgacgctg gaacaggcgc gccaggcaat cctcgacgcg       480
     ctgaagcaga aggccgtcga gccggatgtc atcgtcacct cgacgtcgac cgcttcgcgc       540
     atcgtcaccg tctccggtgc cgtcggccgg ccgtcggtgg tgccgctcaa tcttgtcagc       600
     gaaacgatca acgaggtcat cgccaaggcc ggcggtccct cggcgcagcc ctacgagacc       660
     tatgtcacgc tggtgcgcgg caagaagacc ggcacggttc tgctgaagtc gatcatcgag       720
     agcccgtcgg aaaacatcca tgtcaagcag ggcgaccaga tcttcgtcac ccgcgatccg       780
     cgcaccttta cgattctcgg ccaggtgcgc gccaaccagc gcgtcgagtt cggcgccaac       840
     gacctgaatc tcctcgaagc cgtggcgctc gccggcggcg gggcggatcg caccatcgac       900
     gcgaagggct atttcgtctt ccgctacgag gagccggaca tcgtcatgag cctgctcggc       960
     cgggagcgct tcaataccat gttgagcaag ggcatgcagc ccgacagggt cggtcgctac      1020
     ccgatcgtct accgcttcaa catgacgaac ccggacagcc tgatcgtcgg acagaccttc      1080
     ccgatcaaga accgcgacgt gatctacgcc tcgcgccatc cctcggtcga catcacgaaa      1140
     ttcatggatt tcatcgcccg gccgatcggc atcgcgaatt ccggcgtcaa catcgccgac      1200
     aatctcgacg atctcaacaa ttaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page