(data stored in ACNUC7421 zone)

EMBL: CP001389.PE209

CP001389.PE209       Location/Qualifiers
FT   CDS_pept        247325..247537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24013"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW2"
FT                   /protein_id="ACP24013.1"
FT                   /translation="MRQAYSPDDVDVMRGALDVWCALHNVGKDGAEADRAARRILDLMD
FT                   RKKCSADELLAQLGDFRPEPRQRAF"
     gtgcgtcaag cctattcacc cgatgatgtc gatgtcatgc gcggagcact ggatgtctgg        60
     tgcgccttgc acaatgtcgg caaggatgga gcagaggccg acagggccgc tcggcgcatc       120
     ctcgacctga tggaccggaa gaagtgctcc gccgacgagc ttctcgctca gctcggagac       180
     ttcagaccgg aaccgcgcca gcgggctttc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page