(data stored in ACNUC7421 zone)

EMBL: CP001389.PE211

CP001389.PE211       Location/Qualifiers
FT   CDS_pept        248060..250324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02150"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24015"
FT                   /db_xref="GOA:C3MFW4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW4"
FT                   /protein_id="ACP24015.1"
FT                   /translation="MAQSDAASKIGPENQGPEEAEPSRDHPGRSDGAAFPKTRKALAGL
FT                   GRALTRLGRALRAEVPVAAHRAGEKSKAAALGAFERLRRTSSGKAGSSASAGRSASRWL
FT                   KARRGAASEDRQVMPKRPIGRRAILLRSAAAATLASFVLLAVVFAWALRDVPWNEIAKG
FT                   SLKPVVVLEAADGKPLVSQGPFQGSYAARKDFPPHLVEAVLAREDRRFYEHSGIDLRGI
FT                   ARAIYTNLGAGEVVQGGSTITQQLIKILYLERDRTWKRKIQEAVIAFWLERKLGKDEIL
FT                   TRYLNNIYLGAGATGVPAAARIYFDKEVQDLNIGESAMLAAIIRAPSQLNPLTNPEGAR
FT                   QQAELVLDAMVKGDRITPEEAKVARADVGKLQPTSPAIRSGSWFADWIMQDARELAGPY
FT                   RGTIKVRTTMAPRLQAIAEKVVADALKREGPKAGASQAALVAMTPEGAVVAMVGGRDYT
FT                   KSTFNRAVQAMRQPGSAFKLFVYYAALKRGLTPFDPVEDAPIEINGWSPENFGGGYRGV
FT                   VSIAEAFARSLNAATVALAMEVGIDEVIAAARELGIDAKLADTPSLALGSSEVNLLDLT
FT                   GAYASVRAGRAPIEPWGIEALHAEGQPQAFRVGPSREAATDISQYRPDLVSLLRLVVQR
FT                   GTGREADIGTFAAGKTGTSQNHRDAWFVGFTEPLIVGVWVGNDDETPMKDVTGGKLPAR
FT                   IWKNFMTAALAAGTPEESEAQAAGSAPACNFRACARAYRSFRPDDCTFQPYYGPRRLCE
FT                   K"
     atggcgcaaa gcgatgccgc gtcgaagatt ggcccggaga accaggggcc agaagaagcc        60
     gagccgagcc gcgatcaccc gggccgttcg gacggcgccg catttccaaa aacccgaaag       120
     gcacttgccg gactgggccg tgcgctgacg agacttggcc gggcgctgcg cgcggaagtg       180
     cccgttgctg cccatcgggc cggtgaaaaa tcgaaagcag cggcgcttgg cgccttcgaa       240
     cgcctgcggc ggacctcgag cggcaaggcc ggatcctccg cttcggcggg gcgctcggca       300
     agccggtggt tgaaggcgcg gcgaggcgcg gcaagcgaag atcggcaagt catgccgaag       360
     cgccccatcg gcagacgcgc aatcctgctg cgcagcgccg cggcggcgac cctggcgtcg       420
     ttcgtcctgc tcgccgtcgt cttcgcctgg gcgctgcgcg atgttccctg gaacgagatc       480
     gccaaagggt cgctgaagcc ggtcgtggtg ctggaagccg ccgacggcaa gcctctggtg       540
     agccaggggc cgtttcaggg ctcctacgcg gcacgcaagg attttccgcc gcatctcgtc       600
     gaggcggtgc tcgccaggga ggaccgccgt ttctacgagc attccggcat tgatttgagg       660
     ggcatcgccc gggcgatcta caccaatctc ggggcgggcg aggtggtgca gggcggcagc       720
     accatcaccc agcagctcat caagatcctc tatctcgagc gcgaccgcac ctggaagcgg       780
     aagatccagg aggcggtgat cgccttctgg ctggagcgca agctcggcaa ggacgagatc       840
     ctcacccgct atctgaacaa catctatctc ggcgccggcg cgaccggtgt gccggcggcg       900
     gcgcgcatct atttcgacaa ggaggtgcag gacctcaata tcggcgagtc ggcgatgctc       960
     gcggcgatca tccgcgctcc ctcgcagctc aatccgctga ccaatccgga gggcgcccgc      1020
     cagcaggcgg agctggttct cgatgccatg gtgaagggcg acaggatcac cccggaagag      1080
     gccaaggtcg cccgcgccga cgtcggcaag ctccagccga ccagtccggc gattcgctcg      1140
     ggaagctggt tcgccgactg gatcatgcag gatgcccgcg agctcgccgg cccctatcgc      1200
     ggcacgatca aggtccggac caccatggcg ccgcggctgc aggcgatcgc cgaaaaggtc      1260
     gtcgccgacg cgctgaaacg ggaaggcccc aaggcgggcg cctcgcaggc cgcactggtg      1320
     gcgatgaccc cggagggcgc cgtcgtcgcc atggtcggcg gccgcgacta tacgaagagc      1380
     accttcaacc gcgccgtcca ggcgatgcgc cagcccggct cggccttcaa gctgttcgtc      1440
     tattatgcag ccctgaagcg gggcctgacg cctttcgacc cggtcgagga tgcgccgatc      1500
     gagatcaacg gctggtcgcc cgaaaatttc ggcggcggct atcgcggcgt ggtcagcatc      1560
     gccgaagcct tcgcacggtc gctgaacgcc gcaacggtgg ccctggcgat ggaggtcggg      1620
     atcgatgagg tcatcgccgc ggcccgggaa ctcggcatcg acgccaaact tgccgatacg      1680
     ccgagcctcg cgctcggttc ctcggaggtg aacctgcttg atctgaccgg cgcctatgcc      1740
     tcggtccggg ccggccgggc gccgatcgag ccatggggca tcgaggcgct gcacgccgaa      1800
     gggcagccgc aggccttccg cgtcggcccg tcccgggagg cggcgaccga tatcagccag      1860
     taccggccgg atctcgtttc gctgttgcgg ctggtcgtcc agcgcggcac cggccgcgaa      1920
     gccgatatcg gcacgttcgc cgccggcaag accggcacca gccagaacca ccgcgacgcc      1980
     tggttcgtcg gcttcaccga accgctgatc gtcggcgtct gggtcggcaa cgacgacgag      2040
     acaccgatga aggacgtcac cggcggcaag ctgccggcac ggatctggaa gaacttcatg      2100
     acggcggcgc tcgccgccgg cacgccggag gagagcgagg cgcaagcggc cggctccgcg      2160
     ccggcctgca acttcagggc ttgcgcgcgg gcctatcggt cgttccggcc ggatgattgc      2220
     acattccagc cgtattacgg gccgagaagg ctgtgcgaga agtag                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page