(data stored in ACNUC7421 zone)

EMBL: CP001389.PE213

CP001389.PE213       Location/Qualifiers
FT   CDS_pept        250837..251283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24017"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW6"
FT                   /protein_id="ACP24017.1"
FT                   /translation="MRGHHFTLSPTCPRRTSGFGRSLKPINRPGGQAPLRRIGSRGADP
FT                   SPRAAEGIRQCSGPAVAHTRGGLFSGVVAQHSAPPMPLRKSPKSAAEGTSGGVLDVPPW
FT                   HMRITDDLGRNLLGANVLTGIAPEQTAHEYMRLAKADQQERSAA"
     ttgaggggac accacttcac cctgtcgccg acgtgtccaa ggcggacatc tggatttggg        60
     cgctccttaa aaccaataaa taggccgggc gggcaagccc cgctcagacg gatcgggtcc       120
     agaggggcgg acccgagtcc cagagctgcc gaggggatac ggcaatgctc tgggcccgcc       180
     gtggcccaca ccagaggggg attgttctcc ggcgtggtag ctcagcattc tgctccgccg       240
     atgcccttga gaaaatctcc caaatcggcg gcggagggta cctccggcgg agtgctcgat       300
     gtgcctccct ggcacatgcg aattactgac gatctcggca ggaacctttt gggcgccaat       360
     gtgttaactg gaatcgctcc cgagcaaacg gcgcatgaat atatgcgcct cgccaaggca       420
     gaccagcagg agcgatcggc ggcgtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page