(data stored in ACNUC7421 zone)

EMBL: CP001389.PE214

CP001389.PE214       Location/Qualifiers
FT   CDS_pept        251911..252156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24018"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW7"
FT                   /protein_id="ACP24018.1"
FT                   /translation="MSKYEGLTYRLARERLREIILTFKEIESLIGAALPKSARRPQFWA
FT                   NTSDPEQSRPGNRAAREAGCRSFLLAGHDKVRFVRA"
     atgtcgaagt acgaggggct tacgtaccga ctcgcgaggg agcggttgag agagatcatc        60
     ctgaccttca aggagatcga atcgcttatc ggcgctgcgt tgccgaagag tgcgaggcgg       120
     cctcagttct gggcaaatac aagcgaccct gaacaatctc ggcctgggaa tagggcggca       180
     cgcgaggccg gctgtcgaag ctttctgctg gcaggacacg acaaggtccg cttcgttcgc       240
     gcttga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page