(data stored in ACNUC7421 zone)

EMBL: CP001389.PE215

CP001389.PE215       Location/Qualifiers
FT   CDS_pept        252165..252563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24019"
FT                   /db_xref="GOA:C3MFW8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW8"
FT                   /protein_id="ACP24019.1"
FT                   /translation="MAWLSEVLDQTTVLSLLAGIVVGLPAYFVVSALIRDDRPSPAPRR
FT                   SPRRRKRSSIPGIAVAAAIALFGVSQYVPLIPGCDIKGNVSYNSGERIYHIPGQEDYGQ
FT                   TRVNYFDGERWFCSEASAREAGWRRAYN"
     gtggcttggc tgagtgaagt tctcgatcag acaacggttc tcagtctgtt ggcgggcatc        60
     gtggtcggat tgccggccta ctttgtcgtg tcagccctca ttcgcgatga tcgaccatcg       120
     cctgcgccgc ggagatcgcc acggcgcagg aaaaggagct cgattcccgg catcgccgtt       180
     gccgcggcaa ttgccctctt tggcgtttcc caatacgtgc cgctgatccc cggttgcgat       240
     atcaagggca acgtcagcta caactctgga gagcggatct atcacatccc aggacaggaa       300
     gattacggcc agacgcgcgt caattacttc gacggggagc ggtggttctg ctccgaggcg       360
     tcggcacgcg aagctggctg gcgacgggca tacaactag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page