(data stored in ACNUC7421 zone)

EMBL: CP001389.PE218

CP001389.PE218       Location/Qualifiers
FT   CDS_pept        255039..255479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24022"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX1"
FT                   /protein_id="ACP24022.1"
FT                   /translation="MDALKLLALDEEDLGVVSAHVQDAVFKVAGIHYDARRRQFSLVIN
FT                   RFVWETAEGKRKNFERRRALLLFKCVTAVRSLGFDRADMEAVLDLLAVQFLVKGEGPDG
FT                   TVELVLAGEASIALDVECIEAQLADTGGAWETAFRPRHPEGD"
     atggatgctt tgaagctgct ggcactcgac gaggaggacc tgggggtcgt ttccgctcat        60
     gtgcaggacg cagtcttcaa ggtggccggc attcactacg atgcgcgccg ccggcagttt       120
     tccctcgtca tcaaccgctt cgtctgggaa acggcggaag gcaagcgcaa aaacttcgag       180
     cggcggcgtg ccttgctgct cttcaaatgc gtcaccgccg tgcgctcgct cggcttcgac       240
     cgggccgaca tggaagcggt gctcgatctc ctggcggtgc aattcctggt caagggggag       300
     gggcctgacg gaacggtcga gctggtgctc gccggcgagg cctcgatcgc gctcgatgtg       360
     gaatgcatcg aggcgcagct tgccgatacc ggcggggcgt gggaaaccgc gttcaggccg       420
     cgtcatcccg aaggcgactg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page