(data stored in ACNUC7421 zone)

EMBL: CP001389.PE22

CP001389.PE22        Location/Qualifiers
FT   CDS_pept        20006..20383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00220"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23826"
FT                   /db_xref="GOA:C3MEK3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK3"
FT                   /protein_id="ACP23826.1"
FT                   /translation="MFRASGATFQASQADRKSKKTKGAKVIKSELVQIVAARNPHLYHR
FT                   DVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVFVEEKWVPF
FT                   FKTGKELRERLNPGMNDRDDD"
     gtgttccggg cgtccggcgc gaccttccaa gcgtcacaag cagacagaaa aagcaaaaaa        60
     accaaggggg cgaaagtgat caagtcagaa ctggtgcaga ttgtggccgc gcgcaatccg       120
     cacctctatc accgtgatgt cgaaaatatc gtcaatgcgg tcctcgatga gatcactgat       180
     gccctcgcgg ccggaaaccg ggtcgaactg cgcggcttcg gagccttctc ggtgaagaac       240
     cggccgtcgc gctcgggccg caacccgcgt accggcgatt ccgtcttcgt cgaggaaaaa       300
     tgggtgcctt tcttcaagac cggcaaggag ctgcgcgagc ggctcaatcc cggcatgaac       360
     gacagggatg acgactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page