(data stored in ACNUC7421 zone)

EMBL: CP001389.PE220

CP001389.PE220       Location/Qualifiers
FT   CDS_pept        256816..257292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24024"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX3"
FT                   /protein_id="ACP24024.1"
FT                   /translation="MRADRHLRLCDVVLDETIGRSTPDVEHERAVAIFDLLEENLFEPA
FT                   GHPGGPYRLNLSLVDSKLVFAISTDGGEAVATHILSLTPFRRIVKDYFLICESYYEAIR
FT                   SATPSQIEAIDMGRRGIHNEGSQTLMDRLSGKIRLDFDTARRLFTLVCVLYWRG"
     atgagggccg accgccacct cagactctgc gatgtcgtgc tggacgagac gatcggccgc        60
     tcgaccccgg acgtcgagca cgagcgcgcg gttgcgatct tcgatctcct ggaggagaac       120
     ctgttcgagc ccgccgggca tccgggcggt ccctatcggc tcaatctgtc gctcgtcgac       180
     tcgaagctcg tcttcgccat ctcgaccgac ggcggcgagg cggttgccac ccacattctg       240
     tcgctcaccc cctttcgccg catcgtgaag gactatttcc tgatctgtga aagctattac       300
     gaggcgatcc gatcagcgac gccgagccag atcgaggcga tcgacatggg ccgtcgcggc       360
     atccacaacg agggctcgca gacgctgatg gatcggcttt ccggcaagat caggctggat       420
     ttcgatacgg cgcggcgcct cttcacattg gtctgcgtgc tctattggcg cggctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page