(data stored in ACNUC7421 zone)

EMBL: CP001389.PE223

CP001389.PE223       Location/Qualifiers
FT   CDS_pept        258204..258824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02280"
FT                   /product="predicted septum formation protein, Maf-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24027"
FT                   /db_xref="GOA:C3MFX6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX6"
FT                   /protein_id="ACP24027.1"
FT                   /translation="MTVTQKLILASGSPRRVELLAQAGIEPARLLPMDLDETPKRAEHP
FT                   RSLARRLSAEKAKAALAAVKGEPSWDGSYILAADTVVCVGRRILPKPELVSEASSALHL
FT                   LSGRSHRVYTGICLVTPDRTIRQKVVDTKVRFKRLSGLDIETYLASGQWRGKAGGYGIQ
FT                   GIAGSFVVKLVGSYTNVVGLPLYETVNLLIGEGYDVHGRWLEG"
     atgacagtca cccagaaact gatattggcc tccggatcgc cgcgtcgcgt cgagcttttg        60
     gcacaagccg gcatcgagcc ggcgcgcctg ctgccgatgg acctcgacga gacgcccaag       120
     cgcgccgagc acccccgctc gctggcacgc cggctttccg ccgagaaggc caaggcggca       180
     ctggcggcgg tcaagggcga gcccagctgg gacggcagct atattctggc ggccgacacg       240
     gtcgtctgcg tcggccgccg catcctgcct aagccggagc tcgtcagcga agcctcgagc       300
     gcgctgcatc tcctgtccgg ccgcagccac cgcgtctata ccggcatctg cctcgtcacg       360
     ccggatcgga cgatccgcca gaaggtggtc gacaccaagg tccgcttcaa gcggctttcg       420
     ggcttggaca tcgagacgta tcttgcctcc ggtcaatggc ggggcaaggc cggcggctat       480
     ggcattcagg gcattgccgg aagtttcgtc gtcaaactcg tcggctccta tacgaatgtg       540
     gtaggcttgc cgctctatga aaccgtcaat ctcctcatcg gcgagggata cgacgtccat       600
     ggtcgctggc tggaaggctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page