(data stored in ACNUC7421 zone)

EMBL: CP001389.PE225

CP001389.PE225       Location/Qualifiers
FT   CDS_pept        complement(259599..260963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02310"
FT                   /product="putative transmembrane response regulator protein
FT                   with GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24029"
FT                   /db_xref="GOA:C3MFX8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX8"
FT                   /protein_id="ACP24029.1"
FT                   /translation="MGPLTYETAFERDPPPGAHLASGSCSTKWANMDVQESAISTDRVS
FT                   PSTKLQVQDPAVLSEVERLLAGRTRDIRLKGKLRLLFQERSWPRTAKIVRAWMTWVVVL
FT                   DVVTLALNAILLPKAIALSMLLPACLLPPAAMATAFVWQRPRAQWLQRISIIAGLFLIF
FT                   LSVALVGVSAGGEFYERHLNIMLFVAITAIIIFGVPLNWTVTVASLALGLYLVFQLQNP
FT                   SLEKGSAVAATLFFASGIIATVVARRTMTILAQKTFLLELRDRSRVAELADANARLERL
FT                   ARTDPLTGISNRRWMMETLDHLWSDGMERRGCAMLMCDIDEFKNLNDRLGHAEGDRCLV
FT                   KVAGIIQSSVRRNRDHVARYGGEEFLIVLPGVDEREAIAMGERIRGSVEAASLPNPASR
FT                   VLPYVTLSIGVAAQRPGDEIIPPERLQNQADAALYLAKQAGRNRVVLHKAGALGT"
     gtggggccgt taacctatga aacggcattc gaacgcgacc cgccccccgg cgcgcacctt        60
     gccagcggaa gttgctccac taaatgggcc aatatggacg tccaggagag tgcgatttcc       120
     acggatcggg tgagcccgtc cacaaagctc caggtgcagg atcctgctgt cttgtctgag       180
     gtcgagcgcc tcctcgcggg ccgcacgcgc gacatccgtc tcaaaggcaa gcttcgcctc       240
     ctgttccaag agcgttcctg gccgcgaacg gccaagatcg ttcgcgcctg gatgacatgg       300
     gtggttgtcc tggatgtggt gacgctggcg ctcaacgcaa ttctgcttcc aaaggcaatc       360
     gcactgtcga tgcttctgcc agcctgcctc ctcccgcccg ccgccatggc cacggccttc       420
     gtctggcaaa ggccgcgcgc gcagtggctt caaaggattt ctatcatcgc aggccttttc       480
     ctcatcttcc tgtcggttgc tctggtgggc gtcagcgcgg gtggcgagtt ctacgaacgg       540
     cacttgaaca tcatgctgtt cgtagcgatc accgccatta tcatcttcgg cgttccactg       600
     aactggacgg tgacggtcgc ctcccttgcg cttggccttt atctggtctt ccaattgcaa       660
     aaccccagcc tggaaaaggg aagcgccgtg gcagcgaccc tgtttttcgc cagcggcatc       720
     atcgccactg tggttgcccg acgcaccatg actatcctgg cccagaagac ttttctgctt       780
     gagctcagag acagaagccg cgtcgcggaa cttgccgacg caaatgcgcg ccttgaacgc       840
     ctcgcgagaa cggatccctt gaccggaatc tccaaccgcc gctggatgat ggagacgctc       900
     gaccatctct ggagcgatgg aatggagcgc cgcggctgtg ccatgctgat gtgcgatatc       960
     gacgagttca agaacctgaa cgatcggctg ggccatgcgg aaggtgatcg ctgcctggta      1020
     aaggtcgccg gcataattca gagcagcgtg aggcggaatc gcgatcacgt ggcccgctac      1080
     ggcggtgaag agttccttat cgtgcttccg ggagtggacg agcgagaggc aattgccatg      1140
     ggcgagcgaa ttcgcgggag cgttgaagcg gcctccctcc ccaatcctgc ctcgcgcgtg      1200
     ttaccctatg tcacgctcag catcggagtg gcggctcaga ggccgggtga cgagatcatt      1260
     ccgccggagc ggctccagaa ccaggctgac gcggcactct atctggcaaa acaagctggc      1320
     cgcaatcgcg tggtgcttca caaagcaggt gcgctgggga cttga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page