(data stored in ACNUC7421 zone)

EMBL: CP001389.PE226

CP001389.PE226       Location/Qualifiers
FT   CDS_pept        complement(261079..266142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02320"
FT                   /product="conserved hypothetical protein, contains ice
FT                   nucleation protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24030"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX9"
FT                   /protein_id="ACP24030.1"
FT                   /translation="MTSIISSLSVTQIKNLSTTAVASLTTEDVAAMTTAQVKALSSTQI
FT                   AALDTEDVAIFSTAQLSAIAATSVAGISLDQLAAIDSAKIASLATSQVAALSSAQIDGL
FT                   SSDQAEALTTSQVAALGSAQLAAFSSEDITTFSTAEIAAISVTALAGLSTDNLAALSTD
FT                   QAAALKTTQVAALKTTQVAALTTDQIGALSSSQIAVLSSTQVKALSTDNIAALSTDQVA
FT                   ALNSKTVAALTSAQIDALSSDQAEALTTAQVASLTSTQVAALASEDIATFSTADIAAIT
FT                   VTALTGLSTDNVAALSTDQAAALKTTQVAALKTAQVAALTSDQVVALTSSQVGVLSSTQ
FT                   ISALSTDNVAALTTDQVAALNSKTVAALSSAQIGALSSDQVEALSAVQIAALDSADIAA
FT                   LASEDIATFSTSEIAAITATALSGLSTDNVAALSTDQTAALKTSQIAALKTAQIAALTS
FT                   DQVVALTSSQVGSLSSTQISALTTDNVAALSTDQVAALNSKTVAALSSTQIGALTSDQA
FT                   EALTTAQVAALTSTQIAAFASEDIAAFSTADIAAITVTALGGLSTDNVAALSTDQAAAL
FT                   KTTQVAALKSTQIAALTSDQVLALTSSQVGALTSTQVKALSTDNVAALSTDQVAALNSK
FT                   TVAALSSAQVDALSSDQAEALTTAQVASLGSTQIAAFASEDIAGFSTADIAAITVTALT
FT                   GLSTDNVAALSTDQAAALKTTQVAALKTAQIAALTSDQVVALTSSQVGALTSSQVSAIS
FT                   TDNIAALSTDQVAALNSKTVAALTTAQIEALSSTQVEALTSVLVGALSSTQLSVLASED
FT                   IAAFSTADIAAITVTALGGLSTDNVAALSTDQAAALKTTQVAALKSTQIAALTSDQIEA
FT                   LSTAQIGALTSTQASAISTDSLAALSTDQVAALNTKTLASLSTVQIDAMSSDQLEALTS
FT                   AQVAALTMAQLGALASEDVATFSTADIAAITVAALAGLSTDNVAALSTDQAAALKTTQI
FT                   AALKTAQIAALTSDQVVALTSSQVGALSSTQISALSTDNVAALSTDQVAALNSKTVAAL
FT                   SSVQIDALSSDQAEALTTAQVAALGSTQLAAFASEDLATFSTADIAAITVTALVGLSTD
FT                   NLAALSTDQAAALKTTQVAALSTAQVGALTSDQVVALTSSQVGALTSTQVKALSTDNVA
FT                   ALSTDQVAALNSKSVAALTSVQIEALTSDQAEALTTAQVASLTSTQVAALASEDIATFS
FT                   TADIAAITVTALAGLSTDNVAALSTDQAAALKTTQVVALKTAQIAALTSDQVVALTSSQ
FT                   VGALTSTQISALSTDNVAALSTDQVAALNSKTVAALSSTQIEALSSDQAEALTSAQIAA
FT                   LDSADIAALASEDIATFSTSEIAAITATALLGLSTDNVAALSTDQAAALKTAQIAALKT
FT                   AQIAALTSDQVAALTTSQVGTLSSTQIAVISTDNIAALTTDQVAALNSKTVAALTSTQI
FT                   EALSSDQAEALTTAQVAALGSAQVAALASEDLATFSTADIAAITVTALTGLSTDNLAEL
FT                   STDQAAALKTTQVAALSTAQIGALTSDQVAALSSAQIGALTSTQLTALSTDNVAALTTD
FT                   QVAALSSKVIGALSSDQIDALSTDQVEALTSAQVAALDSADIAALSTDDIATFSTADIA
FT                   AISTTALAGLSTDDIMSLSSDQLVAVTTTQVEALDDSQVEAIIAAYQAI"
     atgacttcca tcatctcttc tctgagcgtc acccagatca aaaacctctc gaccaccgca        60
     gttgcctccc tgactacgga agacgtcgcg gctatgacca ctgctcaggt caaggcgctc       120
     tcctcgaccc agatcgcggc gctcgatacg gaagatgtcg cgatcttctc caccgcacaa       180
     ctgagcgcca ttgccgcaac ctcggtcgcc ggcatcagcc tcgaccagct ggcagccatc       240
     gattcggcca agatcgcaag cctggcgacg tctcaggtag cggccctgag ctcggcacag       300
     atcgacggcc tcagctccga ccaggcagag gccctgacca cgtcgcaagt cgccgcgctc       360
     ggctcggcgc aactcgcagc ctttagctct gaagatatca ccaccttctc caccgccgag       420
     atcgcagcga tctccgtcac ggcgctcgca ggtctttcca ccgacaatct cgccgccctg       480
     tcgaccgatc aggccgctgc gctgaagacc acccaggttg cagcgctgaa gaccacccag       540
     gtcgccgcgc tcacgacgga ccagatcggc gcgctcagct cttcgcagat cgccgtcctc       600
     agctcgactc aggtaaaggc actttccacc gacaacatcg cggcgctttc caccgaccag       660
     gttgccgcgc tcaactcgaa gaccgtcgcg gccctgactt cggcacagat cgacgcgctc       720
     agctccgacc aggccgaggc tctgacgact gcgcaagttg cgtcgctgac ctcgacgcag       780
     gttgcggctc tcgcctcgga ggatatcgcc accttctcga ccgccgatat cgcggcgatc       840
     accgtcaccg cgctcaccgg tctctccacc gacaatgtcg cggcactctc cactgatcag       900
     gccgcagcct tgaagaccac ccaggtcgca gcgctgaaga ccgcccaggt cgccgccctc       960
     acctcggacc aggtcgtggc actcacctcg tcgcaggtcg gtgtcctgag ctcgacgcag      1020
     atttcggccc tctcgaccga caatgtcgcc gcactcacca ccgaccaggt cgcggcgctc      1080
     aactcgaaga ccgtcgcggc gctgagctcg gcacagatcg gcgcgctgag ctccgatcag      1140
     gtcgaggctc tgtccgccgt tcagatcgcg gcgctcgact cggccgacat tgcggctctg      1200
     gcctccgagg acatcgcgac cttctcgact tcggagattg ccgcaatcac cgcgaccgcc      1260
     ctctcgggcc tctcgaccga caatgtcgcg gcactgtcga ccgaccagac cgcggcactg      1320
     aaaacctccc agatcgctgc gctgaagacg gcccagatcg ccgccctcac ctccgaccag      1380
     gtcgtggccc tcacttcgtc ccaggtcggg tccctgagct cgacgcagat ttcggcgctt      1440
     accaccgaca atgtcgccgc actttccacc gaccaggtcg cggcattgaa ttcgaagacc      1500
     gtcgccgcgc tgagctcgac acagatcggc gcgctaacct ccgaccaggc cgaggctctg      1560
     accaccgcgc aggtggccgc gctcacctcg acgcagattg cggctttcgc ctcggaagat      1620
     atcgccgcct tctcgaccgc cgacattgca gcaatcaccg taacggcgct ggggggtctt      1680
     tccaccgaca atgtcgcggc gctctccacc gatcaggccg cggcgctgaa gaccacccag      1740
     gtcgcggcgc tgaagagcac ccagatcgcc gccctcacct cggaccaggt cttggcgctc      1800
     acctcgtcgc aggtcggagc actgacctcg acgcaggtaa aggcgctctc gaccgacaac      1860
     gtcgcggcgc tctccaccga ccaggtcgcc gccctgaact cgaagaccgt tgcggcgctt      1920
     agctcggcac aggtcgatgc tctgagctcg gatcaagcgg aagctctgac cacggcgcaa      1980
     gtcgcatcgc tcggctcgac gcagatcgcg gctttcgcct cggaggatat cgccggcttc      2040
     tcgaccgccg acattgcggc aatcaccgtc acggcactga cgggtctttc gaccgacaac      2100
     gtcgcagcac tctccaccga tcaggccgcg gcgctgaaga ccacccaggt tgccgcgctg      2160
     aagaccgccc agatcgccgc cctcacctct gaccaggtcg tggcgctcac ctcgtcccag      2220
     gtcggagcgc tgacctcgtc gcaagtatct gcaatcagca ccgacaatat tgcggcactc      2280
     tccaccgacc aggtggcggc gctgaactcg aaaaccgtcg ccgctctgac cacggcacag      2340
     atcgaggcgc tcagctccac ccaggtcgag gcgctgacct cggttcttgt cggcgcgctc      2400
     agctcgacgc agctctccgt cctggcctcg gaagatatcg cagccttctc gaccgccgac      2460
     attgcggcaa tcaccgtgac ggcgctcgga ggtctctcca ccgacaatgt cgcggcactc      2520
     tccaccgacc aggccgcggc gctcaagacc acgcaggtcg cggcgctgaa gagcacccag      2580
     atcgccgccc ttacctcgga ccagatcgag gccctgagca ctgcccagat cggtgcgctg      2640
     acctcgacgc aagcgtccgc gatcagcacc gacagcctag ccgcactgtc caccgaccag      2700
     gtggctgcgc tcaacaccaa gaccctggcc tccctgtcga cggtgcagat cgatgcgatg      2760
     agctccgatc agctcgaagc gctgacctcg gcgcaggtcg cggctctgac catggcacag      2820
     ctgggtgctc tcgcctcgga agatgtcgca accttctcga ccgccgacat cgcggcgatc      2880
     acggtcgcag cgctggcagg cctgtcgacg gataacgtcg cggcattgtc gaccgaccag      2940
     gctgcagcgt tgaagaccac gcagatcgct gcgctgaaga cggcccagat cgccgccctc      3000
     acctctgacc aggtcgtggc gctcacctcg tcgcaggtcg gagccctgag ttcgacgcag      3060
     atttcggcgc tctccactga caatgtcgcc gcactctcca ccgatcaggt cgccgccttg      3120
     aactcgaaga cggtcgccgc cctgagctcg gtacagatcg acgcgctcag ttccgaccag      3180
     gcggaggctc tgaccacggc acaagtggcc gcgctcggct cgacgcagct cgccgccttc      3240
     gcctcggagg atctcgcgac cttctcgacc gccgacatcg cggcaatcac ggtcacggcg      3300
     ctcgtcggtc tctccaccga caatctcgcg gcgctctcga ccgatcaggc tgcagcgctg      3360
     aagaccactc aggtcgcggc gctctccacc gcccaggtcg gggcgctcac ctcggaccag      3420
     gtcgtggcgc tcacctcgtc gcaggtcgga gctctgacct cgacgcaggt aaaggccctc      3480
     tcgaccgaca atgtcgcggc gctttctacc gatcaggttg cagcgctcaa ctcgaagagc      3540
     gtcgcggccc tgacttcggt ccagatcgag gcgctcacct ccgaccaggc cgaggcgctg      3600
     accacggcgc aagttgcgtc gctgacctcg acgcaggttg cggctctcgc ctcggaggat      3660
     atcgccacct tctcgaccgc cgacatcgcg gcgatcacgg tcacggcgct ggcaggtctc      3720
     tcgacggaca acgtcgcggc tctgtcgacc gaccaggccg cagcgctgaa gacgacccag      3780
     gtcgtggcgc tgaagaccgc ccagatcgcc gcgcttacct cggaccaggt cgtggcgctc      3840
     acctcgtcgc aggtcggagc cctgacctcg acgcagattt cggcgctctc caccgacaat      3900
     gtcgccgcac tctccaccga ccaggtcgcg gcgctcaact cgaagacggt cgcagcgctg      3960
     agttcgacac agatcgaagc gctgagctcc gatcaggcag aggcgctgac ctccgcccag      4020
     atcgcggcgc tcgactcggc tgacattgcg gccctggcct ccgaggacat cgctaccttc      4080
     tcgacttcgg agattgcggc aatcaccgcg accgcgctgc tgggtctttc gaccgacaat      4140
     gtcgcggcac tgtcgaccga ccaggccgca gcgctgaaaa ccgcccagat cgcggcgctg      4200
     aaaaccgccc agatcgcggc tctcacctcg gatcaggtgg ctgcgctgac cacgtcccag      4260
     gtcgggaccc tgagctccac gcagattgcg gtgatctcca ccgacaatat cgcggcgctc      4320
     acgaccgatc aggtcgcggc gctgaactcg aagacggtcg cagctctgac ttcgacgcag      4380
     atcgaagcgc tgagttccga ccaggccgag gcgctcacca ccgctcaagt ggccgcactc      4440
     gggtcggcgc aagtcgcagc cttggcctcc gaggatctcg caaccttctc gaccgccgac      4500
     atcgcggcga tcacggtcac cgcgctgacg ggtctctcga ccgacaatct cgcggaactg      4560
     tccaccgatc aggcggcggc gctgaagacc acgcaggtcg cggcactctc caccgcccag      4620
     atcggggcgc tcacctcgga ccaggtcgca gcactctcct cggcccagat cggtgccctg      4680
     acctcgacgc aactgaccgc gctcagcacg gacaatgtcg cggctctcac caccgaccag      4740
     gtcgcagccc tgagctcgaa ggtcatcggg gcgctcagct ccgaccagat cgacgcgctc      4800
     tccaccgacc aggtcgaggc actgacctcg gctcaggtcg cagcgctgga ctcggccgat      4860
     atcgcggccc tgtctaccga tgatatcgcg accttctcga ccgccgacat cgccgcgatc      4920
     agcacgacgg cactggccgg cctgtccacg gacgacatca tgagcctgtc gagcgaccaa      4980
     ctggtggccg tcacgacaac gcaggtggaa gccctggacg actcgcaggt ggaggcgatc      5040
     atcgcggcct accaggccat ctaa                                             5064
//

If you have problems or comments...

PBIL Back to PBIL home page