(data stored in ACNUC7421 zone)

EMBL: CP001389.PE227

CP001389.PE227       Location/Qualifiers
FT   CDS_pept        266825..268882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02330"
FT                   /product="conserved hypothetical protein contains
FT                   tetratricopeptide protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24031"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY0"
FT                   /protein_id="ACP24031.1"
FT                   /translation="MTIYTHLASDPASPLAGFLERARQQRLPLTELFQFAESFNAAGQR
FT                   EQAAELYKSWIAYNDSNPLLHLVYFNYSVTLRQMGDLAGSIHALRACLKFEPRFGQGHI
FT                   NLGRALEDAGLTGQAIQQWQVYAEATSEITPERAAHRLMVLQHMGRVLENAGLMEEAES
FT                   TLWKAIELRPDKTEAGQHWTSLRQRQCKWPTLAPSEHVSARQLLDALSPLTLACYADDP
FT                   VFQLAKAYRYCKSLVGRPDLSGFPKLQPRQKSGTGQRLRVGYVSSDLRDHAVGFALSEV
FT                   FETHDKSSVEIYAYYCGEARTGDATQTRMMSTIDCWRDISAISDSDAAKQIIADEIDIL
FT                   VDVNGYTKHARTRIFAYRPAPVIVSFCGYPGTMGSPFHQYVIADEQIIPPENEIYYSEK
FT                   VLRIPCNQPVDRKRQIAPRPSRAEAGLPEDGFIFACFNGAQKITAACFDRWMAILAATP
FT                   GSCLWLLGGGEDVDQRLKQAAQQRGVAPERLIFASKAPNPKHLARIGLADLFLDTFPYG
FT                   AHSTAGDALTMGLPVLTFPGNGFASRFCSSIVAAAGVPELICEGPDDFVRKAIGFAKDR
FT                   QSLASVREALESRRDASVLRDIPALVRRLEELLWQMQGECERGETPVPDLSNLDIYYEV
FT                   GAEIMKENVEFVDSAAYRQRYVEKLAEWHAFSPIPFDSRLWTAATAGARR"
     atgaccatct acactcatct cgcctccgat cctgcttcgc ccctcgccgg tttcctggaa        60
     agggcgcgac agcaacggct tccgttgacg gaactgttcc agtttgcgga gagcttcaat       120
     gccgccgggc aaagggagca ggccgccgaa ctctacaaat cctggatcgc ctacaacgat       180
     tccaatccgc tgcttcacct tgtctatttc aactactcag tcacgctcag gcagatgggc       240
     gatcttgccg gctccatcca tgcgctgcgc gcttgcctga agttcgaacc acgcttcggc       300
     cagggccata tcaatctcgg ccgagcgctg gaggatgccg gactgacggg tcaggcgatt       360
     caacaatggc aagtctatgc cgaggcgacc tccgagatca cgccggagcg cgctgctcat       420
     cgcctgatgg tcctccagca catgggccgg gtgcttgaga atgccggtct catggaggag       480
     gcggaaagca cgctgtggaa ggcgattgag ctgaggcccg acaagaccga agccggccag       540
     cattggacgt cgctcaggca acgccagtgc aaatggccga cactggcccc ttcggaacat       600
     gtttcggccc ggcaactgct cgacgcgcta tccccgttga cccttgcctg ttatgccgac       660
     gatccggttt tccagcttgc caaggcctat cgctactgca agtcgcttgt cggccgaccc       720
     gatctgagcg gcttcccgaa gcttcagcct cgccaaaagt ccggaaccgg gcagcgattg       780
     cgtgtcggct acgtgtcgtc cgacctgcgc gatcatgcgg tcggctttgc gctcagcgaa       840
     gtcttcgaaa cgcacgacaa gagcagcgtc gagatctacg cctattattg cggcgaagcg       900
     cggaccggcg acgccacgca gacgcggatg atgagcacca tcgactgctg gcgcgacatt       960
     tccgccatca gtgacagcga cgctgccaag cagatcatcg ccgacgaaat cgacatcctg      1020
     gtcgatgtca acggctatac gaaacacgcc cgtaccagga tcttcgccta ccggccggca      1080
     ccggtgatcg tcagcttctg cggctatccg ggtacgatgg gcagcccctt ccaccaatac      1140
     gtcatcgccg acgagcagat catcccgccg gagaacgaga tctactattc ggaaaaggtg      1200
     ctgcggattc cctgcaacca gcccgtcgac cgcaagcggc agatcgcacc gcggccaagc      1260
     cgggctgaag cggggctgcc cgaggacggc ttcatattcg cctgcttcaa cggcgcgcag      1320
     aagatcaccg ccgcttgctt cgaccgctgg atggcgatcc ttgccgcgac gcccggcagc      1380
     tgcctctggc tgctcggcgg cggtgaggac gtcgatcagc gcctcaagca ggcggcccag      1440
     cagcgcggcg tcgcgcccga gcgcctgatc ttcgcttcga aggcccccaa tcccaagcat      1500
     ctggcgcgca tcggactggc cgatctgttc ctcgacacct tcccctatgg ggcgcattcc      1560
     accgcgggcg atgcgctgac catgggattg cccgttctga cattccccgg caacggcttc      1620
     gcttcgcggt tctgctcgag catcgtcgct gcggccggcg tgcccgaact catttgcgag      1680
     ggaccggacg acttcgtccg aaaggcaatc ggatttgcga aggaccggca gagcctcgca      1740
     agtgtcagag aggccctgga gagccgccgt gacgccagcg tgttgcgcga cattccggcg      1800
     ctcgtccggc gcctggagga attgctctgg caaatgcagg gcgagtgcga gcgcggcgaa      1860
     acgcccgtgc ccgatctcag caatctcgac atctattacg aggtcggggc tgagatcatg      1920
     aaggaaaacg tggagttcgt cgacagcgcc gcctatcggc agcgctacgt cgagaagctc      1980
     gccgagtggc acgccttttc gccaatcccg ttcgactccc gcctgtggac agcggcgaca      2040
     gccggcgccc gtcgataa                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page