(data stored in ACNUC7421 zone)

EMBL: CP001389.PE228

CP001389.PE228       Location/Qualifiers
FT   CDS_pept        268914..270167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24032"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY1"
FT                   /protein_id="ACP24032.1"
FT                   /translation="MAPVILVTFAGRQKRMEILTRYIHSAMDAGIIDEWHVWDFTRSQQ
FT                   DHEWVTREFGPVRYMGSAAPYQSNGSIAPNQALRLGATITNDLHLAIVPNDGSDDYFEL
FT                   VVGGWSNSHSVLRKLPLSQLRSFDRNDVPALWSRPTPGILSPGTANQIVINVDAAGVPS
FT                   LHVNNVAIGHWPELDLSAGASVMVRGGWGADLELGNVRSRIQRFVGNPNEQMPYWQAYD
FT                   YYAKRLKIFSDSIFLKCDDDIVYMDLEKLSDFIEFRRTNPKYIVVSANVVNNGVCAHWQ
FT                   QVAGSIPVGVGHFERPPGGFGGSLWQSAERANELHDYFLQTNDKHLPLPSKVIEWTERQ
FT                   SINFIAWLGKDLVHMALPKGDDERALTVDLPLLLDRPTAIYSDFTVSHLSFGPQEQGLA
FT                   LDRLIDAYDELMRNALAA"
     atggctccgg ttatacttgt cacattcgca ggccgacaga agagaatgga aatcctcacc        60
     cggtatatcc attccgccat ggatgccggg atcatagacg aatggcatgt gtgggatttc       120
     acccgctcac agcaggatca tgaatgggtg acgcgcgaat tcggacctgt ccgctatatg       180
     ggctccgccg cgccctacca gtccaacgga tcgatcgctc ccaaccaagc gctgcgcctc       240
     ggcgcaacga tcaccaatga ccttcatctc gccatcgttc cgaatgacgg cagcgacgac       300
     tatttcgaac tggttgtcgg cggctggagc aattcgcact cggtattgcg taaactgcca       360
     ttgagccagc ttaggagttt tgaccgcaac gatgtaccgg cgctgtggag caggcccact       420
     ccgggcatcc tgtcgccggg caccgccaac caaatcgtca tcaatgtcga tgcggcgggt       480
     gttccttcgc tccatgtcaa caacgtcgcg atcggccact ggccggaact ggacttgtcg       540
     gccggtgcgt ccgtcatggt cagaggcggg tggggtgcgg atctcgaact tggcaatgta       600
     cgctcgcgca tccagcgttt cgtcggcaac ccgaatgagc agatgcccta ttggcaggcc       660
     tatgactact acgccaagcg gctgaagatc ttctcggact ccatattttt gaagtgcgac       720
     gacgacatcg tctatatgga tctcgaaaag ctcagcgatt tcatcgaatt caggcggacc       780
     aacccgaaat acatcgttgt atccgccaat gtggtgaaca atggagtatg cgcccattgg       840
     cagcaagtgg cgggctccat tcccgtgggg gtaggtcact tcgaacggcc gccgggcggg       900
     tttggcggaa gcctctggca gagcgcggag cgtgccaatg agttgcacga ctacttcctg       960
     cagaccaacg acaagcacct gccgttgccg agcaaggtga tcgagtggac cgaacgccag      1020
     tcgatcaact tcatcgcctg gctcggcaag gacctcgtgc atatggcctt gccgaaggga      1080
     gacgacgagc gcgcgcttac ggtcgatctg ccgctgctgc tcgatcggcc gacggcgatc      1140
     tattcggatt tcaccgtcag ccatttgagc ttcggaccgc aggagcaggg cctggccctc      1200
     gatcgcttga tcgatgccta tgacgaactg atgcgcaacg cgctcgccgc gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page