(data stored in ACNUC7421 zone)

EMBL: CP001389.PE23

CP001389.PE23        Location/Qualifiers
FT   CDS_pept        20500..20841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23827"
FT                   /db_xref="GOA:C3MEK4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK4"
FT                   /protein_id="ACP23827.1"
FT                   /translation="MFKKIVNIVVLVPLGVILIALSVANRQTVTLALNPFDTADSVLSV
FT                   SAPFFLFLFLAVVVGLVLGAAAVWLSQGKYRRRARSEAHEALKWHREAEKHRSEAERLS
FT                   QVNLPAPQN"
     atgttcaaga aaatcgtcaa tatcgtcgtg ctcgtaccgt tgggggtcat cctcatcgcc        60
     ttgagcgtcg ccaaccgcca gacggtgacg ctggcgctca atcccttcga tacggccgac       120
     agcgtgcttt cggtatccgc gccctttttc ctcttcctgt ttctcgcagt ggtcgtcgga       180
     ctggtcctcg gagcggccgc ggtctggctc agccagggaa aataccgtcg ccgcgcgcgc       240
     agcgaggcgc atgaggcgct gaagtggcat cgcgaggcgg aaaagcaccg cagcgaggcc       300
     gaaaggttgt cgcaggtgaa tctgccggca ccgcagaact ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page