(data stored in ACNUC7421 zone)

EMBL: CP001389.PE230

CP001389.PE230       Location/Qualifiers
FT   CDS_pept        271818..278894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02360"
FT                   /product="conserved hypothetical protein, contains ice
FT                   nucleation protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24034"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY3"
FT                   /protein_id="ACP24034.1"
FT                   /translation="MTSIISSLSPTLIKSYSTAAVAAWTTEDVASLTTKQISAMSSAQI
FT                   AALDTEDVDVLSSRQLGAISPSAIVGLTLEQLAVLDQSDIESFGTSQVAALTTKQIDGL
FT                   SAEQAEALSSTQVGALSALQLSVLTEEDLESFSTADIAAIGAKAITGLPADVVASLSTD
FT                   QIAGLSTRAVAALSTAQIAALSTDQLAALTTAQVTALKASQIEALGTDDIATLSTQQMA
FT                   ALSASAISGLSTKQIAALSVDQIEALTVSQVKALTAAQLGSLETDGIAAFSTAEIAAIS
FT                   RAVWGLTTEAFAALSTAQVAALNTAAVASLTTAQMAALSADQAEAMSVLQVKALNSRQL
FT                   AALGTEGIATFSTGEIAAIANLAIKGVSTDAIAALSTAQVAALSTSAISGLTTAQSEAF
FT                   SSDQAAVLSAAQLRTLSSAQVAALGTDNIEALSTDQIAALNTKGVMGLTTDQVAALSTD
FT                   QVEALSVTQVKALNALQLEALGTDGLAMFSTGEIAALSNKAILGVDAEVIASLSTDQIA
FT                   ALSTSAVASLTSAQLAALSTDQAEALSVSQVKVLSSAQLAALGEDGIATFSTAEIAAIT
FT                   SKAVPGVSDDAITALSTAQIAALSTTAVASLTTAQVAALSTDQTAALSTAQLKALSSTQ
FT                   LAALSTDNVAALTTVQVAALGTKAVAGLTADQVEALSSDQVAALSTQQVAALGSEQLAV
FT                   LSAEDIAAFSTADIAAISSSAIAGLSADLMEALTTAQIVALSTKGVARLSTDQIDALSS
FT                   DQLAALSSVQVAVLSSAQLSALEAEDIATFSTADIAAIGSKAISGLSEDVVAALTSTQI
FT                   AALSTGGVAGLSTDQMATLSSDQVVALSTKQIAALKSTQVAALSTETVAALSSDLIAAL
FT                   STAGINELTTDQVEALSTDQIVALSTKQVAALSSAQIAALDTSDIAVFSTEQIAVLTTA
FT                   AISGLSTRQIDALSTEQMEALTAVQVGALSSAQLGALGTEDIAVFSTKDIAAISAAAMA
FT                   GLSTAVVAALSTDEIALLSTAGIAGLSSAQLNVLSTSQLAALSTKQAAALTSAQVAALG
FT                   TSGLAALSTDQISVLSAAAIAGLTTKQLVALGAGQMEALTSTQIGALSATQLGVLGAED
FT                   IAAFSTKDIAAIRSTAISSLSTAAIAALSTDQIAAVSAAGIAGLSSAQVNALSATQLAA
FT                   LSTKQVAALTSAQVTALGSSDITALSADQIEALGSAAVAGLTTRQLAALSTDQLEALTA
FT                   VQTGALSSVQLGALGAEDVAVFSTKDIAAIGSSAIAGLSTAAIASLSTEQIGALSAAAV
FT                   SALTTKQIAVLSSGQIAALSTEQLGGLTSQQIAALDADDIKALSIDDIAALGADLVSGL
FT                   STDVIAAFSTDQIAALSTAAVAALSTKQVDALSTGQLAVLTTAQIGALTSRQVDALSTD
FT                   DVATLTTDQIAALSAAGVVGLSTADIAILSSGQVDALTTSQIAALGSKQIAALGTDDIA
FT                   GFSVAEIAALSSSAVAGLSTETIAALSAEQIAALSTAGIAGLSTAQVNALSTDQIGALS
FT                   TEQVAALSSKQVAALGTDDMAALSADQIAALGTTGIAVLSSAQIDALSAEQLEALTSVQ
FT                   VAALSSTQIAALSTDDLAAFSTADIAAISSAAVAGLSTDTLAALSADQIAALSAAGIAD
FT                   LSTAQINALSADQLEALSTDQIAALSSKQVAALGTDDIAALSTEQIAALSTAGVAALST
FT                   AQIQALSADQLEALTPSQVAVMSSTQIAALSTADLESFSSADIGAIGSSAVAGLSTDTL
FT                   AALSADQIAALSATGVAGLSTVQILALSTDQIEALSTDQIAALSSKQLAVLGTDDIAVL
FT                   STDQIAALGTAAIAGLSTTQINALNADQLEAMTSGQVAVMSSTQIAALSTGDLESFSTA
FT                   DIAAISSRAVAGLSTDTIAALSADQIAALGTGGVAGLSTAQINALNTDQVEALTSLQIG
FT                   ALTSQQIAVLGTDDLETFSTDEIAAISSTAVLGLSTDTIAALSVDQVAALSSAGISGLS
FT                   TAQINALSTDQIEALSTAQIGGLGSKQVAALGTADLAVLSTSQIAALSTAGIAGLSSEQ
FT                   VGALSDEQVEALSTVQIAAMSSDALSGLSTDDLEGFSVEELAAISSSAIRGLSTDFIAG
FT                   LSTAEIAALGTASLAGLSSAQVGAMSAEQIDTLSTLQIAALSADGLAGLTTEDLGTFTT
FT                   GELVAISAAAIKGLSTTFVAALSTAEIAALTASQVGSLSYNQVAAMSTTQIATLSTAQL
FT                   SALNAIQAAALGTDDIAQLSTDDIVALGTSAISGLTTRVVAALTTDQAEALTAVQVGAM
FT                   TSAQVAALETEDLATFSAEDVASFSSYGVAGLSTEDIGNLSSTQLNALMDSQMDALDSD
FT                   QIAAVIAAYLGM"
     atgacctcca tcatttcgtc cctcagcccc actctgatca aatcctattc gacagcggcc        60
     gttgctgcct ggacgacgga agacgtggct tcgctgacga cgaagcagat cagcgcgatg       120
     tcgtcagctc agatcgcggc gctcgacacg gaggatgtcg atgttctcag ctcccggcag       180
     ctgggcgcca tatctcccag cgccattgtc ggtttgaccc tggagcaact cgccgtcctc       240
     gaccaatccg acatcgagag cttcggtacg agccaggtcg cggccctgac gaccaagcag       300
     atagacggtt tgtcggcgga gcaggcggag gcgttgagct cgacccaggt cggagccttg       360
     agcgccttgc agctctcggt cttgaccgag gaagacctgg agtccttctc gaccgccgac       420
     atcgccgcca tcggcgcgaa agccataacc gggctcccgg ccgatgtcgt cgcatccctt       480
     tccacggatc agattgccgg cttgagcacc cgtgccgtcg ccgccctgtc gaccgcgcag       540
     atcgccgccc tgtccaccga tcagcttgcc gccttgacga ccgcccaggt cacagcgctg       600
     aaggcctcgc aaatcgaggc cttgggcacc gacgacattg ccacgctttc cacccagcag       660
     atggctgcgt tgagcgcctc ggcaatttcg gggctttcca ccaaacagat cgccgccctg       720
     tcggtcgacc agatcgaggc actgaccgtc tcgcaggtga aggcgctgac ggcggcgcaa       780
     ctcgggtccc tcgagaccga cggcatagcg gcattctcga ctgccgagat cgcggcgatc       840
     agcagggccg tatggggctt gacgacggag gccttcgccg cactctccac cgcccaggtt       900
     gccgccctga acacggccgc cgtcgccagc ctgacgacgg cgcagatggc cgccttgtcg       960
     gctgaccagg ccgaggcgat gtccgtcttg caggtgaagg cactgaattc gagacagctt      1020
     gcggcgctcg ggaccgaggg cattgcgaca ttctcgaccg gcgaaatcgc cgcgatcgcc      1080
     aacctggcca tcaagggcgt gagcacggac gcgatcgctg cactttcgac cgctcaggtt      1140
     gcggcgctca gcacgagtgc gatctcgggc ttgacgaccg cacagagcga ggcattttcc      1200
     tccgaccagg ccgcggtcct ttccgcggca cagctgcgga cgctgagctc ggcgcaagtc      1260
     gccgcacttg gcaccgacaa tatcgaggcg ctctccacag accagatcgc ggcgctcaac      1320
     accaagggcg tcatgggcct gacgaccgat caagtcgccg ccttgtcgac cgaccaggtc      1380
     gaggctctgt ccgtcacaca ggtgaaggcc ctgaacgcac tgcagcttga ggcgctcggg      1440
     accgacggct tggcaatgtt ctctaccggc gagatcgccg cactcagcaa caaggccatt      1500
     ctgggggtgg acgccgaggt cattgcgtcc ctgtctaccg atcagatcgc ggcgctcagc      1560
     acgagtgcgg tcgccagcct gacgagcgcc cagctggcgg ctttgtcgac cgaccaggcg      1620
     gaggccttgt ccgtctcgca ggtgaaagtc ctgagctcgg cccagctcgc cgcccttggg      1680
     gaagacggga ttgcgacgtt ctcgaccgcc gagatcgcgg cgatcaccag caaagccgtg      1740
     cccggcgtca gcgacgacgc cataacagcg ctttccacgg cccagatagc ggcactcagc      1800
     acgactgcag tcgcgagcct gacgaccgca caggtcgccg ccttgtcgac cgaccagacc      1860
     gcggccctct ccaccgcgca gcttaaagcc ctgagttcca cgcaactcgc cgccttgagc      1920
     acggacaacg tcgcggcttt gaccacggtt caggtcgccg cgcttggcac caaggcggtc      1980
     gccggcctaa ccgccgatca ggtcgaagcc ttgtcgtccg atcaggtcgc ggctctctcc      2040
     actcaacagg ttgccgccct cggctccgag cagcttgccg ttctcagtgc agaggacata      2100
     gcggcattct cgaccgccga tatcgcggcg atcagttcga gcgccattgc cggattgtcg      2160
     gcagatctca tggaagccct cacgacggcc cagatcgtag cgctcagcac gaagggcgtc      2220
     gcgcgcctca gcaccgatca gatcgacgcg ctgtccagcg accagcttgc agccttgtcg      2280
     tcagtccagg ttgccgttct aagctccgcg cagctctcgg ccctggaggc ggaggacatt      2340
     gcaaccttct cgactgccga tattgccgca ataggctcca aggccatttc cggcctgtcg      2400
     gaggatgtcg tcgccgccct gacctcgacg cagattgccg cgctcagcac cggcggcgtt      2460
     gccgggctga gcacggatca gatggcgacg ctgagctccg accaggtcgt cgctttgagc      2520
     accaaacaga tcgcagcgct gaaatcgacg caagtcgccg ccttgagtac ggagactgtc      2580
     gcggccctgt cctcggacct gatcgccgcg ctcagcactg caggcatcaa cgaactgacc      2640
     accgatcagg tcgaggcgct atccaccgac cagatcgtgg cgctgagcac caagcaggtt      2700
     gccgcgctga gctctgcgca aatcgccgcg ctggacacca gcgatatcgc ggtgttttcg      2760
     accgaacaga tcgccgtgtt gacgacggcc gcgatcagcg ggctgagcac caggcagatc      2820
     gacgcgctga gcaccgagca gatggaagcc ctgaccgccg tgcaagtcgg cgcgctcagc      2880
     tcggcgcagc tgggggcgct cggaacggaa gacatagcgg tcttctcgac gaaggacatc      2940
     gcggccatca gcgccgctgc gatggcggga ctgtcgacgg ccgtcgtggc cgccctttcc      3000
     accgatgaga tcgctcttct gagcactgcc ggcattgccg gcctcagcag cgcgcagttg      3060
     aacgtgctca gcaccagcca gctcgccgcc ttgagcacca agcaggccgc tgcgctcact      3120
     tcggcgcagg tggccgcctt gggtacgagc ggacttgcgg ccctctcgac ggatcagatc      3180
     tcggtcctca gtgccgctgc catcgcggga ctgaccacca agcagctcgt tgccctgggc      3240
     gccggtcaaa tggaagccct gacctcgacc cagatcggcg ccttgagcgc gacgcagctc      3300
     ggggttctgg gggcggaaga cattgcggcg ttctcgacca aggacattgc cgctatccgg      3360
     tcgaccgcca tttcgagcct ctcgacggcc gccatagctg ccctctcgac cgatcagatc      3420
     gccgccgtaa gcgcggccgg cattgccggt ctgagcagcg cgcaggtcaa cgcgctcagc      3480
     gccacgcagc tcgccgccct gagcaccaag caggttgccg cgctcacgtc ggcgcaagtc      3540
     accgccctgg ggtcgagcga tatcaccgcg ctttccgccg atcagatcga ggccttgggt      3600
     tcggcagccg tcgcgggcct gaccaccagg cagctcgctg ccttgagcac ggatcagctg      3660
     gaggccctga ccgcggtcca gactggcgcc ctgagctcgg tgcagcttgg agccctgggc      3720
     gcggaagacg tggcggtctt ctcgaccaag gacatcgcgg cgatcggttc gagtgccata      3780
     gcaggactgt ccacggctgc catcgcttcg ctctcgaccg agcagatcgg cgccctgagc      3840
     gcggccgccg tgtcggcatt gaccaccaaa cagatcgctg ttctgagttc cggccagatt      3900
     gccgcgctgt cgaccgaaca gctcggcggg ctgacctcgc agcagatcgc tgcgctggat      3960
     gcggacgaca tcaaggcgct gtcgatcgac gacatcgcgg cgcttggcgc ggatctcgtt      4020
     tccggccttt caacggacgt catagctgcc ttctccaccg accagatcgc cgcgttgagc      4080
     acggccgccg tcgcggcgtt gagcaccaag caggtcgatg ccttgagcac cggtcagctt      4140
     gcggtcttga ccacggccca gatcggggcg ctcacctcca gacaggtcga tgccttgagc      4200
     acggatgacg tggcgacgct cacgaccgac cagatcgccg ctttgagcgc ggccggcgtg      4260
     gtcggcctga gcaccgcgga catcgccatc ctgagctcgg gccaggtcga tgccctgacg      4320
     acgagccaga tcgcggctct cggctccaag caaatcgccg ccttgggcac ggacgacatt      4380
     gcaggcttct cggtcgcgga aattgcggcc ctcagttcga gtgcggtagc gggactgtcc      4440
     accgagacga ttgcggcgct ttcggcggaa cagatcgcgg ccttgagcac ggccggcatt      4500
     gccggccttt ccaccgccca ggtcaatgcg ctgagcaccg accagatcgg ggcgctgtcg      4560
     accgaacagg tcgctgctct cagctccaag caggtggcgg cgctgggcac cgacgacatg      4620
     gcggcgcttt cggcggacca gattgccgcg ctgggtacga ccggcattgc ggtcctttcc      4680
     agcgcacaga tcgatgcgct gagcgccgaa cagctcgaag ccctgacttc cgtccaggtc      4740
     gcggcgctga gttcgacgca gatcgctgcg ctcagcaccg atgatctggc cgccttctcg      4800
     accgcggata ttgcggcgat cagttcggct gccgtggcgg ggctgtccac cgacacgctg      4860
     gcggcgcttt cagcggatca gatcgccgcc ctgagcgcgg ccggtatcgc cgacctttcc      4920
     acggcccaga tcaatgcctt gagcgccgac cagctcgaag cgctgagtac cgaccagatc      4980
     gccgcgctta gctccaaaca ggtggcggcg ctgggcacag acgacatagc ggcgttgtcg      5040
     acggaacaga ttgccgcgct gagcaccgcc ggcgttgcag ctctttccac ggcgcagatc      5100
     caggcgctga gcgccgatca gctcgaggct ctgaccccga gccaggtggc ggtgatgagt      5160
     tcgacgcaga tcgctgcgtt gagcaccgcc gatctggaga gcttttccag cgcggatatc      5220
     ggcgcgatcg gttcgagcgc cgtagccggc ctgtccaccg acacgctggc cgcgctttcg      5280
     gcggaccaga tcgccgccct gagtgcgacc ggcgtcgccg gtctttccac cgtgcagatc      5340
     ctggcgctga gcaccgacca gatcgaggcc ctgtcgaccg accagattgc cgccctcagc      5400
     tccaagcagc tggcggtgct gggaaccgac gacattgcgg ttctctctac ggaccagatt      5460
     gccgcgctgg gtacggccgc aatagcgggc ctttccacga cccagatcaa cgcgctgaat      5520
     gccgatcagc tcgaggccat gacctccggc caggtcgcgg tcatgagttc gacgcagatc      5580
     gcggcgctga gcacgggcga tctggagagc ttctcgaccg ccgatatcgc ggcgatcagt      5640
     tcgcgcgccg tagcggggtt gtccaccgac acgatagcgg cgctttcggc ggatcagatc      5700
     gcggccctcg gcaccggtgg cgtcgccggc ctttccaccg cccagatcaa cgcgctgaac      5760
     accgaccagg tcgaggcgct cacttctctc cagattggcg cgctgacttc gcagcagatc      5820
     gccgtcctcg gcaccgacga tctggagacc ttctcgacgg acgagatagc ggcgatcagt      5880
     tcgactgccg tgttgggact gtcgaccgac acgatagcgg cgctttcggt cgatcaggtt      5940
     gcggccttga gctcggccgg catttcgggg ctttccaccg cccagatcaa tgcgctgagc      6000
     accgaccaga ttgaagcctt gtcgaccgcg cagatcggcg gcctcggctc caaacaggtg      6060
     gcggcgctcg gcaccgcgga tctcgcggtg ctgtcgacga gccagattgc agcgctgagc      6120
     acggcgggca ttgcgggcct gagcagcgag caggtcggcg ctttgagcga cgagcaggtc      6180
     gaagcccttt ccaccgtcca gattgccgct atgagctcgg atgcgttgtc aggccttagc      6240
     accgatgacc tggaggggtt ctcggtcgag gaacttgcgg cgatcagctc ttcggccatc      6300
     aggggcttgt ccacggattt catcgccgga ctgtccaccg ccgagattgc cgctctgggc      6360
     acggcgagcc ttgcgggtct gagcagcgct caggtcgggg cgatgagcgc cgaacagatc      6420
     gatacgctgt ccaccctcca gattgccgcc ttgagcgccg acgggctcgc cggtctgacc      6480
     accgaggacc tcggcacgtt cacgaccgga gaactggtgg cgatcagcgc ggccgccata      6540
     aagggactgt ccacgacctt tgtcgccgcg ctttccacgg ccgagatcgc cgccctgacg      6600
     gcaagccagg tcgggtcgct gagctacaac caggtggcgg cgatgagcac cacgcaaatt      6660
     gccaccttgt ccaccgcgca gctcagtgct ctgaacgcca tacaggccgc ggccctgggg      6720
     acggacgaca tcgcccagct ctccaccgat gatatcgtcg ccttgggcac gagtgcgatc      6780
     tccggactga ccaccagggt cgtcgccgcc ttgacgacgg atcaggcgga ggccctgacg      6840
     gccgttcagg tcggggcgat gacctcggcg caggtcgcgg ccttggagac cgaggatctg      6900
     gcgaccttct cggcggagga tgtcgcctcg ttcagctcct atggggtcgc ggggctatcc      6960
     acggaagaca ttggcaatct gtccagcacg cagctgaacg ccttgatgga ctcgcagatg      7020
     gacgctctgg attccgatca gatcgcggca gtcattgcgg cctatctggg gatgtaa         7077
//

If you have problems or comments...

PBIL Back to PBIL home page