(data stored in ACNUC7421 zone)

EMBL: CP001389.PE232

CP001389.PE232       Location/Qualifiers
FT   CDS_pept        280172..280360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24036"
FT                   /db_xref="GOA:C3MFY5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY5"
FT                   /protein_id="ACP24036.1"
FT                   /translation="MSMGEGVGTPVVGDGPSSCAFACSHLERGQGSGQMTMHMMKVLLS
FT                   LMAALSFGSFMVLVAVL"
     atgtcgatgg gagagggggt cggcacgccg gttgtcggcg acgggccgtc gagttgtgcc        60
     ttcgcttgtt cccatttgga gcgcgggcaa ggatctgggc agatgacaat gcacatgatg       120
     aaagtgctgt tgagcctgat ggccgcgctt tcgttcggct cgttcatggt tctcgtggcc       180
     gttctgtag                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page