(data stored in ACNUC7421 zone)

EMBL: CP001389.PE233

CP001389.PE233       Location/Qualifiers
FT   CDS_pept        complement(280398..280859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02390"
FT                   /product="conserved hypothetical protein, contains
FT                   YbaK/aminoacyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24037"
FT                   /db_xref="GOA:C3MFY6"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY6"
FT                   /protein_id="ACP24037.1"
FT                   /translation="MSLTSVKEFFSKRAPDIDVIELEQSTATVALAAEGHGVEPAQIAK
FT                   TLALRVGDDVVLIVTRGDARLDNKKYKARFGTKARMLGSSEVETETGHPVGGVCPFGLV
FT                   KPHTVYCDESLKAFDVVVPAAGAINAAVHISPHRMAELTGAEWIDVSET"
     atgagcctca cctccgtcaa agagttcttt tccaagcgcg ccccggacat cgacgtcatc        60
     gaactcgagc aaagcaccgc aacggtggcg ctcgcggccg agggacacgg cgtcgagccg       120
     gcacagatcg ccaagacgct ggcgcttcgc gtcggcgacg acgtcgtcct gatcgtcacg       180
     cgcggcgacg cccgcctcga caacaaaaaa tacaaggccc gcttcggcac caaggcgcgc       240
     atgctcggct ccagcgaggt cgagaccgag accggccatc cggtcggcgg cgtctgcccg       300
     ttcggccttg tgaagccgca cacggtctat tgcgatgaat ccttgaaggc gttcgatgtg       360
     gtcgtgcccg ccgccggcgc aatcaacgcc gccgttcaca tcagtccgca ccgcatggcg       420
     gaactgaccg gcgcggaatg gatcgacgtg tcggaaacct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page