(data stored in ACNUC7421 zone)

EMBL: CP001389.PE234

CP001389.PE234       Location/Qualifiers
FT   CDS_pept        complement(280944..281132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24038"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY7"
FT                   /protein_id="ACP24038.1"
FT                   /translation="MSDFYAEKIETALQSYMSDHPATSTRQQAISTILENWFASHGYLP
FT                   PQQEGLRPEDLDASNDD"
     atgagcgatt tctatgcaga aaagatcgaa acggcgctgc aatcctatat gagcgatcac        60
     cccgccacgt cgacgcgcca acaggcaatc tccacgatcc tggaaaactg gtttgcaagc       120
     catggctacc tgccgccgca acaggagggc ctgcgaccgg aagaccttga cgcgtcgaac       180
     gacgactga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page