(data stored in ACNUC7421 zone)

EMBL: CP001389.PE235

CP001389.PE235       Location/Qualifiers
FT   CDS_pept        complement(281304..281591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02410"
FT                   /product="hypothetical protein"
FT                   /note="similar to transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24039"
FT                   /db_xref="GOA:C3MFY8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY8"
FT                   /protein_id="ACP24039.1"
FT                   /translation="MFHGHNRKETLMGIESILVFLIVGAIAGWLAGLIVSGFGFGLIGN
FT                   IVVGIIGALIAGYLFPAVGITLGTGILAAIIHSTIGAIILLVLIRIVKQA"
     atgttccatg gacacaaccg caaggagaca ttgatgggta tcgaaagcat tctggtgttc        60
     ctgatcgtcg gcgcgattgc cggctggctc gccggcctga tcgtcagcgg cttcggcttc       120
     ggcctgatcg gcaacatcgt cgtcggcatc atcggcgcgc ttatcgccgg ctatctgttt       180
     ccggcggtcg gcatcacgct cggcacgggc atcctcgctg caatcattca ttcgaccatc       240
     ggggcgatca tcctgctggt gctgatccgc atcgtcaaac aggcctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page