(data stored in ACNUC7421 zone)

EMBL: CP001389.PE239

CP001389.PE239       Location/Qualifiers
FT   CDS_pept        286363..287352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02450"
FT                   /product="rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24043"
FT                   /db_xref="GOA:C3MFZ2"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ2"
FT                   /protein_id="ACP24043.1"
FT                   /translation="MKILKSLMVTAAVAAALMANAAHAENKKIALVVKALGIGFFEAAN
FT                   KGAQEAAKELGDVEIIYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPALKK
FT                   AMDRGIKVISWDSGVAKEGRLMHLNPSSSPLIGNMIIKLAADNLPEGGDVAVLSASATA
FT                   TNQNTWIAEMKKVQVNYKGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAPTSIG
FT                   IVAAAQAVTDAGKIGQINVTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATMIAYDI
FT                   INGAEAKPGAELKMGRMGTVKLDDNNEGAMADPFVYDASNVEEFAKIF"
     atgaaaattc tcaaatcatt gatggtgacg gccgccgtcg cggccgcgct catggcgaac        60
     gccgctcatg cggagaacaa gaagatcgcg ctcgtcgtca aggcgctcgg catcggcttc       120
     ttcgaggccg ccaacaaggg tgcccaggaa gcggccaagg aactcggcga cgtcgagatc       180
     atctataccg gtccgacttc gacgacagcc gagggccaga tcgaggtaat caattcgctg       240
     atcgcccaga aggtcgatgc gatcgcggtt tcggccaacg acaccgacgc actcgtaccg       300
     gcgctcaaga aggcgatgga ccgcggcatc aaggtgattt cctgggattc gggtgtcgcc       360
     aaggaaggcc ggctgatgca tctcaacccg tcgtcgagcc cgctgatcgg caacatgatc       420
     atcaagctcg ccgccgataa cctgccggaa ggcggcgatg tcgccgtgct ctcggcctcg       480
     gcaacggcaa ccaaccagaa cacctggatt gccgagatga agaaggtcca ggtcaactac       540
     aagggcatca acgtcgtggc cacagtctat ggcgacgacc ttgccgacaa gtcctaccgt       600
     gagacgcagg gcctcatcca gtcccatccg aacctgaagg cgatcatcgc gccgacctcg       660
     atcggcatcg tcgcggccgc ccaggccgtc accgacgccg gcaagatcgg ccagatcaac       720
     gtcaccggtc tcgggctgcc ctccgaaatg gccggtcatg tgaagtccgg cgcgtccaag       780
     tccttcgcga tctggaaccc gatcgacctc ggctattcgg cgacgatgat cgcctatgac       840
     atcatcaacg gtgccgaagc caaacccggt gcggaactga agatgggccg catgggaacg       900
     gtcaagctcg acgacaacaa cgaaggcgcc atggccgacc cgttcgtcta tgatgcctcg       960
     aacgtcgaag agtttgccaa gatcttctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page