(data stored in ACNUC7421 zone)

EMBL: CP001389.PE24

CP001389.PE24        Location/Qualifiers
FT   CDS_pept        complement(20887..21345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00240"
FT                   /product="predicted carbon monoxide dehydrogenase subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23828"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK5"
FT                   /protein_id="ACP23828.1"
FT                   /translation="MDITGEERIAARREAVWQCLNDPDILKRCIPGCQAVEAVSPTELT
FT                   AVVKVKIGPVSATFNGKVTLSNLNPPESYTISGEGKGGIAGFAKGGADVTLAEESDETL
FT                   LSYDVKAEVGGKLAQLGSRLIDSTAKKLAQQFFANLNLAVSGAAEAAS"
     atggacatca ccggtgagga gcggatcgcg gcacgccgcg aagcggtttg gcaatgcctg        60
     aacgaccccg acatcctgaa gcggtgcatt cccggctgcc aggcggtcga agcggtctcg       120
     ccaacggaac tcacggccgt cgtcaaggtc aagatcggcc cggtttcggc gacgttcaac       180
     ggcaaggtca cgctctccaa cctgaacccg cccgaaagct atacgatatc gggtgaggga       240
     aagggcggca tcgccggctt cgccaaggga ggtgcggatg tcacgcttgc cgaagaaagc       300
     gacgaaacgc tgctcagcta cgatgtcaag gccgaagtcg gcggcaagct tgctcagctt       360
     ggctctcgcc tgatcgattc gaccgccaag aagctggcgc agcagttctt cgccaattta       420
     aacctcgccg tcagcggtgc cgccgaagcg gcgagttga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page