(data stored in ACNUC7421 zone)

EMBL: CP001389.PE244

CP001389.PE244       Location/Qualifiers
FT   CDS_pept        291461..292831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02500"
FT                   /product="predicted carbohydrate kinase contains FGGY
FT                   family domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24048"
FT                   /db_xref="GOA:C3MFZ7"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ7"
FT                   /protein_id="ACP24048.1"
FT                   /translation="MKTVAVIDIGKTNAKIALVDLEQFEEIAVRKTPNVVVKDGLYPHF
FT                   DVEYLWRFILDSLAALHRERPVDAISVTTHGATAVLLNDAGELAMPVLDYEYAGPDALS
FT                   EEYGQARPPFSETGSARLPMGLNVGAQLFWQQRMFPRDFAEVATILTYAQYWSYRLTGV
FT                   ATNELTSLGCHTDLWNPKTATFSTMVEARGWTPLFAPVRKADEVIGGLLPALAEATGLP
FT                   DRLPVYCGIHDSNASLLPHLLTRSAPFSVVSTGTWVVMMSVGGEQVELDERRDTLINVN
FT                   ALGDPVPSARFMGGRAFSLLIGDDPPPPSAEAERRVLAEGRMLLPSVPGGSGPFPSAEP
FT                   RWTVNEDNLTPAERLAAVSFHLSLMTATCLDLIGARGEIVVEGPFAANSAYLRMLAAAT
FT                   GRLVLANRLSSTGTSLGAACLVAGATIRTGAEAFSEAVPRSYVDYAHKWQRLTAEHV"
     atgaagaccg ttgccgtcat cgacatcggc aagaccaacg ccaagatcgc gctggtcgat        60
     ctcgagcagt tcgaggagat tgccgtccgc aagacgccca acgtcgtcgt gaaggacggt       120
     ctctatccgc atttcgacgt cgagtatctc tggcgattca tccttgatag cctcgccgca       180
     ctgcaccgcg agcgcccggt ggatgcgatt tccgtgacaa cacatggggc gaccgccgtc       240
     ctgctcaacg acgcaggcga gctcgcaatg ccggtgctcg attatgaata tgccggaccg       300
     gatgcgcttt ccgaggaata tggccaagca cgcccgccct tttccgagac cggctcggcc       360
     cgcctgccga tggggctcaa tgtcggtgcg cagctcttct ggcagcagcg catgtttccg       420
     cgagatttcg ccgaggtcgc gacgatcctg acctatgcgc aatattggtc ctatcgtctc       480
     accggcgttg cgacgaacga actgacctca ctcggctgtc ataccgatct gtggaatccc       540
     aagactgcaa cgttctcgac gatggtcgag gcacggggtt ggacgccgct ttttgcgccg       600
     gtgcgcaagg cggacgaggt gatcggcggc ctgcttcccg cccttgccga ggcgacgggc       660
     ctgccggaca gactgccagt ctattgcggc atccacgatt cgaacgcctc gctgctgccg       720
     cacctgctga cccgcagcgc gccgttttcc gtcgtctcga ccgggacctg ggtcgtcatg       780
     atgtcggtcg gcggcgagca ggtggagctc gacgagaggc gcgatacact catcaatgtc       840
     aatgcactcg gcgatccggt cccatctgcc cgcttcatgg gcggccgcgc cttttcgctg       900
     ctgatcggcg acgatccgcc gccaccttca gccgaggccg aacgtcgtgt gcttgcggaa       960
     ggccgtatgc tgctgccgtc ggtgccgggc ggctccggtc ctttcccctc ggcagagccg      1020
     cgctggacgg tgaacgaaga caacctcacc ccggccgagc ggctcgccgc cgtctccttc      1080
     catctttccc tgatgacggc gacctgcctc gatttgatcg gcgcgagggg cgaaattgtc      1140
     gtggaaggtc cgttcgctgc gaattccgcc tatttgcgga tgctggccgc tgcgaccggc      1200
     cggctggtgc tcgccaaccg cctcagcagc accggaacga gcctcggtgc ggcctgcctc      1260
     gtcgcaggtg ccacgatcag gacaggagcg gaagccttct cggaagctgt cccgcggagc      1320
     tatgtcgatt acgcacacaa atggcagcgc ttgaccgccg agcatgtgta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page