(data stored in ACNUC7421 zone)

EMBL: CP001389.PE245

CP001389.PE245       Location/Qualifiers
FT   CDS_pept        293522..295135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02510"
FT                   /product="predicted chemotaxis methyl-accepting receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24049"
FT                   /db_xref="GOA:C3MFZ8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ8"
FT                   /protein_id="ACP24049.1"
FT                   /translation="MQQEASEQARKGQAGSLLERLRFAGLDERACALLRDHRQVLSPSI
FT                   ELALRDLFQRLQANPDAVRHFDSDRQLDRLHDLQSSHWNVLTDARFDGLYAERVKVLAD
FT                   TEARMGLDPRWQLASHAVVLEHLIVGAIENAWPKSLLPFGKARRSELCRLVAALVRAAF
FT                   VDGEIAVSLRFNALRQQHQRHLSDQRKGDESEVAALFSDFLQALGTGDLGARLPTDAPD
FT                   AYRPIAAGLNAALDQIQNALLSGDKRAAAAETIVESLRGRTSEFSGSASGEAEALTGQV
FT                   AALGAMTERMRSGSIRISETETRASETRQAAERSGEIAGQAISAMADIEASAEKIGQII
FT                   GVIDEIAFQTNLLALNAGIEAARAGESGRGFAVVAQEVRALAQRSGEAAREIKQLVNGT
FT                   KTQVEAGVEIVGQTQNAISSIVDQVISINAAVSGIAREAETQVNDLAAAASEIGGISKA
FT                   MARSATLAGEAAASTEDLHGTILELGQTIRRFRFERQAGLRASTIAPPPALLPQVDGDE
FT                   AAMPFSDDTALGRHVAGWRR"
     gtgcagcagg aagcgtcaga acaggcaagg aagggccagg caggcagcct gctcgagcgc        60
     ctgcgctttg ccggcctcga cgagagagcc tgcgcacttc tgcgcgacca tcgccaggtg       120
     ctgtcaccga gcatcgagct tgcgctgcgt gatcttttcc aacggctgca ggccaatccg       180
     gacgccgtcc gtcatttcga cagcgaccgc cagctcgacc ggctgcacga cctccagtcg       240
     tcccattgga atgtcctgac cgacgcccgt ttcgacgggc tttatgccga gcgcgtcaag       300
     gtgctcgccg acacggaagc ccgcatgggg ctcgacccgc gctggcaact cgcaagccat       360
     gcggtcgtgc tggagcatct cattgtcggc gccatcgaga atgcttggcc caaatccttg       420
     cttccgttcg gcaaggcacg caggagcgag ctctgccggc tggtcgccgc actcgtccgc       480
     gccgccttcg tcgacggcga gatcgcggtg tcgctgcgct tcaacgcgct tcgccagcag       540
     caccagcgcc acctctccga ccaacgcaag ggcgacgagt ccgaagtggc ggcgctcttt       600
     tccgatttcc tgcaggctct cggcaccggt gaccttggcg ctcgcctccc cacggatgcg       660
     ccggatgcgt atcggccgat cgccgcaggg ctgaatgccg ctttggacca gatccaaaac       720
     gcgctgctgt ccggcgacaa acgcgccgct gccgccgaaa ccattgtgga aagcctgcgc       780
     ggccgcacga gcgagttttc cggctcggcc agcggcgagg cggaagcgct gaccggccag       840
     gtcgcagcac tcggtgcgat gaccgagcga atgcgctcgg gctcgatcag gatcagcgag       900
     accgagacca gggcgagcga gacgcggcag gctgccgagc gcagcggcga gatcgccggt       960
     caggcgattt ccgccatggc ggatatcgaa gcttcggccg aaaagatcgg ccagatcatc      1020
     ggcgtgatcg acgaaattgc cttccagacc aatctgctcg ccctcaatgc cggcatcgag      1080
     gcggcacgcg ccggcgagag cggccggggc ttcgcggtcg tggcgcagga agtccgggcg      1140
     cttgcgcagc gttcgggcga ggcggcgcgc gagatcaagc aactcgtcaa cggcacgaag      1200
     acgcaggtcg aggccggcgt cgagatcgtc ggccagaccc agaacgcgat cagcagcatc      1260
     gtcgaccagg tgatttccat caacgccgcg gtctccggca tcgcgcgcga ggcggagacg      1320
     caggtgaacg atctggccgc cgcggcctcc gagatcggcg gcatctcgaa ggcgatggcc      1380
     cgaagcgcga cgcttgccgg cgaggcggcg gcttcgaccg aagatctcca cggcaccatc      1440
     ctggagttgg gacagacgat ccgccgcttc cgtttcgagc gccaggcagg cttgagggct      1500
     tcgaccattg ccccgccgcc ggcgcttctg ccgcaagtcg atggggacga agctgcgatg      1560
     ccgttcagcg atgataccgc cctcgggcgg cacgtcgccg gatggcggcg ctag            1614
//

If you have problems or comments...

PBIL Back to PBIL home page