(data stored in ACNUC7421 zone)

EMBL: CP001389.PE246

CP001389.PE246       Location/Qualifiers
FT   CDS_pept        295165..295458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24050"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ9"
FT                   /protein_id="ACP24050.1"
FT                   /translation="MASKNTAKKSLKLAPVLDLNEATALHERLLSLKGSPVAIDASAVE
FT                   RIGTLCAQVLMAGARSWEEDRVSFTFAKVSDAFVKTTQLIGVDIAPLMAKEI"
     atggccagca agaacaccgc aaagaaatcg ctgaagctcg ctccggtcct ggacctgaac        60
     gaggcgacgg cgctgcatga aaggctgctc tcgctcaaag ggtcgcccgt cgcgatcgat       120
     gcgtccgccg tcgagcgcat cggaacgctc tgcgcacagg tgctgatggc cggcgcaaga       180
     agttgggaag aggatcgggt gtccttcacc tttgccaagg tgtcggacgc gttcgttaaa       240
     acgacacagc tcatcggcgt ggacatcgcg cccctgatgg caaaggagat ttga             294
//

If you have problems or comments...

PBIL Back to PBIL home page