(data stored in ACNUC7421 zone)

EMBL: CP001389.PE254

CP001389.PE254       Location/Qualifiers
FT   CDS_pept        301571..301957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG07"
FT                   /protein_id="ACP24058.1"
FT                   /translation="MQTDHQSYMPHAEESLPEVLMRIVTELHDVAYLIERIEPQLWNGH
FT                   DGSATEDKMMVLQGIDLAVQKTRGLAEFIDTITASIPDTCLVDISTAVNLVKLADMKKA
FT                   LGNGLLRHGHSQPLTKASGDFEAF"
     atgcagaccg accaccagag ctacatgcct cacgcggaag aatcgctgcc ggaagtgctg        60
     atgcgcatcg tcacggagct ccatgacgtc gcctacctca tcgagcgcat cgagccacaa       120
     ctctggaacg gccatgatgg atcagcgaca gaggacaaga tgatggtgct tcagggcatc       180
     gaccttgccg tccagaagac ccgggggctc gccgaattca tcgacacgat caccgcgtcg       240
     atccccgaca cctgcctcgt ggatatctcg actgccgtga acctggtcaa gcttgccgac       300
     atgaagaaag cgctcggcaa cggcctgttg cgccacggcc actcgcagcc gctcacgaag       360
     gcctcgggcg atttcgaggc tttctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page