(data stored in ACNUC7421 zone)

EMBL: CP001389.PE258

CP001389.PE258       Location/Qualifiers
FT   CDS_pept        complement(306382..306822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24062"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG11"
FT                   /protein_id="ACP24062.1"
FT                   /translation="MKKCEFSEKREKLVAEAIRPVATELRLIDAADFIALLRFESHASL
FT                   ADLVESAAELYFLPGTVNFGLGGNYNLDWNSRPEIILDLELKPRGVTVYARLVLAGEAA
FT                   GIEISHINFQHPSTDPDENTAFLARSLEEAKFVKSYPLPLAS"
     ttgaagaagt gcgaattctc cgaaaaacgc gaaaaactgg tggcagaggc gattcgtccg        60
     gtggcaaccg aactgcgcct gatcgacgcc gcggacttca tcgccctcct gcggttcgag       120
     tcgcatgcga gcctcgccga cctggtggaa tcagcggcgg aactctattt tctgccgggt       180
     accgtgaatt tcggccttgg cggcaactac aatctcgact ggaacagccg tccggaaatt       240
     attctggacc tcgagttgaa gccccgaggc gtaacggtct atgcgcggct cgtgctggcc       300
     ggggaagcag ccggcatcga gatcagccac atcaacttcc agcatccgtc gaccgatccg       360
     gacgagaaca cggccttcct cgccagaagc ctggaagagg ctaagttcgt caagtcctat       420
     cccctgccac tggcgagcta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page