(data stored in ACNUC7421 zone)

EMBL: CP001389.PE264

CP001389.PE264       Location/Qualifiers
FT   CDS_pept        311691..312596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24068"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG17"
FT                   /protein_id="ACP24068.1"
FT                   /translation="MRLAANPARHRRAEQVRASQYGQDLSRSGHRAGPLLRTGRPIVTT
FT                   TYTSYKLITADITGSLERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKAH
FT                   GLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQK
FT                   GVVDKYARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAALQLPE
FT                   EFAAADVDRQAEAYEEAIDLKDFQDPVKLAAFIDRFTALWEIENSSDSYDPLAVFGSSS
FT                   GYGISPDLLLSINNLKLGGR"
     gtgaggctgg ccgcgaaccc tgctcgccac cggcgcgccg aacaggttcg cgcaagccaa        60
     tacggtcagg atttatcaag gtcgggccat cgcgccgggc cgctactccg cacggggcga       120
     ccgatcgtga ccacgaccta tacgagctac aagctgatta ccgccgacat caccggctcg       180
     ctggagcgcg tctcggagca gccggtcgtg gcgcgcgaga cggaatacta tctttccagg       240
     atcggcagca tcaagtcgct cgacgagttc ttcgccgaca gccggcttta tgattatgcg       300
     atgaaggcgc acggtctgga ggacatggcc tatgccaagg ccttcatgcg caaggtgctg       360
     acggagggca tcgacagcga ggacgctttt gccaataagc tggcggacag ccgctacaag       420
     gccctggtcg aatcgctgaa tttcgcgcgg cacggcgata cggcaacctc gttcgagcgt       480
     gcccaaaagg gcgtcgtcga caaatacgca cgccagacgc tggagcagaa tgccggcgag       540
     gagaatggcg gcgtgaggct ggcactctac ttcgagcgca tggcgcctct gatcaccagc       600
     ggttacgaga tcattgcaga cgaggcgctg gcccaggtgg tgcgggccgc gctgcaactg       660
     cccgaggagt ttgccgcagc cgacgtcgac cggcaggccg aagcctatga ggaggcgatc       720
     gacctcaagg atttccagga tccggtaaag ctcgccgcct tcatcgatcg cttcacggcc       780
     ctttgggaga tcgagaattc ttcggacagc tacgatccgc ttgcggtctt cggttcttcg       840
     agcggctacg gcatttcccc cgacctgctc ctttccatca acaatctgaa actcggggga       900
     cgctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page