(data stored in ACNUC7421 zone)

EMBL: CP001389.PE267

CP001389.PE267       Location/Qualifiers
FT   CDS_pept        314891..315442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24071"
FT                   /db_xref="GOA:C3MG20"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG20"
FT                   /protein_id="ACP24071.1"
FT                   /translation="MTDNEADEIVHQRRRDAKMPLTDKVLGAIGLAMAAFATFFPWYAF
FT                   LHQDQFSIPPLWRGTTRDLPERPGRGVVSVSPLAMTDVDAETAAAIDRLTTATVPGLEH
FT                   QPAAGAGEPQAGPEQPFPEPSGFKLMHVANGRALIEDATGMYIVRIGSVLPDNSRLATF
FT                   EERNGRWVMITSKGQVYQAN"
     atgaccgaca acgaagccga cgaaatcgtc caccagcgcc ggcgcgacgc caagatgccg        60
     ctgaccgaca aggtcctcgg cgcgatcggg ctcgccatgg ctgcctttgc gacgttcttt       120
     ccgtggtacg ccttcctgca ccaggaccag ttctcgatcc cgccgctctg gcgcggaacg       180
     acgcgggatc tgccggagcg ccccggtcgc ggcgtcgtgt cggtatcgcc gctggcgatg       240
     accgatgtgg acgcggaaac cgccgcggcg atcgatcggc tgacgaccgc gaccgtgccc       300
     ggactggagc atcaaccagc tgccggtgca ggcgagccgc aagccggccc ggaacagccc       360
     tttcccgagc cgtccggctt caagctgatg catgttgcca acggaagggc cctcatcgag       420
     gatgcgaccg gcatgtatat cgtccgcatc ggctcggtcc tgccggacaa cagccggctt       480
     gccactttcg aagagcgcaa cggccgctgg gtgatgatca cctccaaggg ccaagtgtac       540
     caggccaact ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page