(data stored in ACNUC7421 zone)

EMBL: CP001389.PE272

CP001389.PE272       Location/Qualifiers
FT   CDS_pept        317584..318093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02780"
FT                   /product="SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24076"
FT                   /db_xref="GOA:C3MG25"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG25"
FT                   /protein_id="ACP24076.1"
FT                   /translation="MMFRRSAERAAIEGRFARLTRPLAFAAIAAALLSPALVSAQQPTA
FT                   VIPKQIIYPGETIEASMLEVVDVTNPDLADGYIGSLEEVEGKVTKRTLLPGRVILASAL
FT                   RDRYAVERGSTVRLIFNNGGLTITAAGSPLEDAAVGELIRARNIDSGVIVSGTVMADGT
FT                   VHVVAK"
     atgatgtttc gccgatccgc cgaaagggca gcaatcgaag gtcgcttcgc gcgcttgacg        60
     cggccgctcg catttgcagc gatcgccgcc gcactgctgt cgccggcgct cgtctccgcg       120
     cagcagccga ccgcagtcat cccgaagcag atcatctatc ccggcgaaac catcgaggcg       180
     agcatgctgg aagtcgtcga cgtgaccaat ccggatctcg ccgacggcta tatcggctcc       240
     ctcgaagagg tcgagggcaa ggtgacgaag cggaccctcc tgccgggacg ggtgatcctc       300
     gcctcggcgc tccgcgaccg ctatgcggtc gagcgcggct cgacggtacg gctgatcttc       360
     aacaatggcg ggctgacgat caccgccgcc ggctcgccgc ttgaggacgc ggcggtcggc       420
     gaactgatcc gcgcccgcaa catcgatagc ggcgtcatcg tctccggcac ggtgatggcc       480
     gacggcacgg tccatgtggt ggcgaaatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page