(data stored in ACNUC7421 zone)

EMBL: CP001389.PE273

CP001389.PE273       Location/Qualifiers
FT   CDS_pept        318090..319205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02790"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24077"
FT                   /db_xref="GOA:C3MG26"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG26"
FT                   /protein_id="ACP24077.1"
FT                   /translation="MTMRVCKWLLTFALLFAATLTPAHSASRIKDVASLQAGRDNQLIG
FT                   YGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQGGESRTRNVAAVLVTATLPPFAS
FT                   PGSRVDVTVGSLGDATSLRGGTLVMTSLSGADGQIYAVAQGSIVVTGFSAQGDAASLSQ
FT                   GVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFSTAVGMAAAINKFASAQFGGRI
FT                   AEALDSQSVLVQKPKMADLARLMADIENLVVETDVPARVVVNERTGTIVIGQDVRVNEV
FT                   AVSYGTLTVQVTETPTVVQPAPFSRGETAVEPNTTIEAQSDGGTVAILNGSSLRSLVAG
FT                   LNSIGVKPDGIIAILQSIKTAGALQAELVLQ"
     atgacgatgc gcgtctgtaa gtggttgctg accttcgcgt tgttgtttgc ggcgacattg        60
     acgcccgctc attccgcgtc gcgcatcaag gacgtggcct cgctgcaggc cgggcgggac       120
     aaccagctca tcggctacgg tctggtggtc gggctgcagg gaaccggcga cagcctgcgg       180
     tcctcgccgt tcaccgacca gtcgatccgc gccatgctgc agaacctcgg catctcgacc       240
     cagggcggcg agtcgcggac gcgcaatgtg gcggcggtgc tggtcaccgc cacgctgccg       300
     cctttcgcaa gccccggcag ccgtgtcgac gtcaccgtcg gctcgctcgg cgacgcgacg       360
     tcgctgcgcg gcggcacgct ggtcatgacg tcgctctcgg gcgccgacgg gcagatctat       420
     gcggtggccc agggctcgat tgtcgtcacc ggcttcagcg cccagggtga cgcagccagt       480
     ttgtcgcaag gcgtgacgac ggccggccgc gtgccgaacg gcgccatcat cgaacgcgag       540
     ctgccgtcga agttcaagga cggcttcaac ctcgtgctgc aattgcgcaa cccggatttc       600
     tcgaccgccg tcggtatggc ggcggcgatc aacaaatttg cctctgcgca gttcggcggc       660
     cgcattgccg aagccttgga ctcgcagtcc gttctcgtcc agaagccgaa aatggccgat       720
     ctcgcccggc tgatggccga catcgaaaat ctcgtcgtcg agacggacgt cccggcccgc       780
     gtcgtcgtca atgagcggac cggcacgatc gtcatcggtc aggatgtgcg cgtcaacgaa       840
     gttgcggtca gctacggcac cctgacggtg caggtgaccg agaccccgac cgtcgtccag       900
     ccggcgccct tctcgcgcgg cgagacggcc gtcgagccga ataccaccat cgaggcgcag       960
     tcggatggcg gcacggtggc gatcctcaac gggtcgagcc ttcgctcgct tgtcgcgggt      1020
     ctcaacagca tcggcgtcaa gccggacgga atcatcgcga tcctgcagag catcaagacg      1080
     gcgggagccc ttcaggcgga gcttgtgctg caatga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page