(data stored in ACNUC7421 zone)

EMBL: CP001389.PE274

CP001389.PE274       Location/Qualifiers
FT   CDS_pept        319202..319741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG27"
FT                   /protein_id="ACP24078.1"
FT                   /translation="MTGTMDLLPGKSRRTLLAAAGGALMLVMPGAFAQDVTAPPAENGA
FT                   TNEIQQFCTNIADAARDQRYLLQRKDLETLQASVDERIATLEKRRAEYEDWLKRRNDFL
FT                   KQAELGLVDIYKTMKPDAAAGKLEMVRPEIAAAIVMKLPARQSSLILSEMSDEKAAVLT
FT                   NIISSASDPNTSKEPS"
     atgaccggaa ctatggacct tcttcccggc aagtctcgcc gcacgctgtt ggccgcggcc        60
     ggcggagcac tgatgctggt tatgccgggc gcattcgcgc aggacgtgac cgcgcctcct       120
     gccgaaaacg gcgcgaccaa cgaaatccag cagttctgca ccaatattgc cgatgcggcg       180
     cgcgaccagc gctacctcct gcagcgcaag gatcttgaga ccctgcaggc gagcgtcgac       240
     gaacgcattg cgacgctgga aaaacgccgg gccgaatacg aggactggct gaagcgccgc       300
     aacgatttcc tcaagcaggc ggaactcggc ctcgtcgaca tctacaagac gatgaagccc       360
     gacgccgccg ccggcaagct cgagatggta cggccggaga tcgccgcagc gatcgtcatg       420
     aagctgccgg cacgccaatc ctcgctgatc ctcagcgaga tgagcgacga gaaggcggcg       480
     gtgctcacca acatcatttc cagcgccagc gacccgaaca cctcgaagga gccatcatga       540
//

If you have problems or comments...

PBIL Back to PBIL home page