(data stored in ACNUC7421 zone)

EMBL: CP001389.PE28

CP001389.PE28        Location/Qualifiers
FT   CDS_pept        24140..26407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00280"
FT                   /product="sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23832"
FT                   /db_xref="GOA:C3MEK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK9"
FT                   /protein_id="ACP23832.1"
FT                   /translation="MSEPFSAQQRKQAGPGAMPAAVDVARSATAMAGRPPPVARRSPVD
FT                   RETSVGHILLAVAGLAAAALLLVAGARAGLHLLPAVAAVGALAGAFLLLSREGAASRQA
FT                   SEPGSGADRTERCSETAKLLSTIHDALGDIALVRGMDGKIVQANAVFSRVCGRVDVRGL
FT                   TCASLGLSFEPRPDPDRFIVRFATPAGLRLYDWHDVVIREPASGRLMRHSIARDVTEEA
FT                   QAVRRGEEARLRAEEASQAKSRLLATVTHEIRTPLSGILGMSHLLAQTQLSAEQRNYLA
FT                   DMQQSGHALVQLVEDLIDFSSLSAGRFQLHPSEQELRLVIENVVEMLSHRAHEKGIEIG
FT                   VAIDASVPPRFGFDAARLRQVLFNVIGNAVKFTEAGGVLVTADYGEGHVRIRVDDSGPG
FT                   MSADELARVFEEFEQAGDHAQRSKGTGLGLAISRRIMEAFGGSLIASSVTGEGSRFEIR
FT                   FPVDEALSAAQPRRGALADAHVLLLAPDGPASMALAATIKTLGGQCHRAPTLSAAREVI
FT                   ARPLAGALPLTDIIVDHRHASQLRQLLLLEPALERQRLRKTCLISPEERSSHPVNRMGG
FT                   YEAWLIRPLREKSLVEVLLGRMTGIEKRDGINDNRPILRAEPRKAAAVSPDRRRVLLAE
FT                   DDPVNALVLRKMLERAGHGVDHVGDFAALEAALQGRAAPGLIVTDFNMPGGDGLALLRR
FT                   LRGVEAAGKGNRVPVVVLTSDVRSDLHRLLLAAGADAVLTKPAEPERFLAEVARLLDAG
FT                   QA"
     atgagcgagc ctttctcagc ccagcagcgc aagcaagccg gcccgggcgc gatgccagca        60
     gccgtcgacg tcgcgcgatc ggcgacggcg atggcaggcc gtcctcctcc ggtagcgcgc       120
     aggtcgccgg tcgaccgcga aacgtccgtt ggccacattc tcctggctgt cgccgggctg       180
     gccgccgcgg cccttctcct cgtcgcgggg gcacgcgccg gccttcatct gctgccggcc       240
     gtagctgcgg tcggtgccct cgccggcgcc tttctgctgc tctcccgcga aggcgccgcg       300
     tcccggcagg cgtcggagcc gggtagcgga gcagatcgga ccgagcggtg ttcggagacg       360
     gcgaagctgc tttcgacgat ccatgatgcg ctcggcgaca tcgcgctcgt ccgcggcatg       420
     gacggcaaga tcgtccaggc gaatgccgtg ttcagtcgag tttgtggccg ggtcgacgtg       480
     cgggggctga cctgtgcttc gctgggcctg agcttcgagc cgcggccgga tccggaccgt       540
     ttcatcgtcc gtttcgcgac gccggccggc ctacgcctct acgattggca cgatgtcgtc       600
     atccgcgagc cggcgagcgg ccggctgatg cgccacagca tcgcccgaga cgtaacggaa       660
     gaggcgcaag cggtgcgccg cggagaggag gcacggctgc gcgccgaaga ggcgagccag       720
     gcgaaatcgc ggctgctggc gaccgtcacg catgagatcc gcacgccgct ttccggcatc       780
     ctcggcatga gccatctgct cgcccagacg caattgtcgg ccgagcagcg gaactatctt       840
     gccgacatgc agcagtccgg tcacgccctg gttcaactcg tcgaggacct gatcgatttc       900
     tcctcgctct cggccgggcg cttccaactg catccgtcgg agcaggaact gcgcctcgtc       960
     atcgagaacg tggtggagat gctttcgcat cgcgcccacg agaaaggcat cgaaatcggg      1020
     gtggcgatcg atgcgagcgt accgcctcgc ttcgggttcg atgcggcgcg tctcaggcag      1080
     gtgctgttca acgtcatcgg caatgccgtc aaattcaccg aagccggcgg cgtgctcgtc      1140
     acggccgatt acggcgaagg acatgtccgc atccgggttg atgacagcgg ccctggcatg      1200
     tctgccgacg aactggcgcg tgtcttcgag gagttcgagc aggccggcga ccacgcccag      1260
     cgctccaagg gaacaggcct cgggctggcg atttcccgcc gcatcatgga ggcctttggc      1320
     ggcagcctca tcgcgtcgag cgttacggga gaggggagcc gcttcgagat tcgctttccg      1380
     gtcgacgagg ccctctcagc tgcgcagccc cgccgcggcg cccttgccga cgcgcatgtc      1440
     cttctgctcg ctcccgacgg ccccgcttcg atggcgcttg ccgcgaccat caagaccctg      1500
     ggcggccaat gccatcgcgc gccaaccctg tcggcggcgc gcgaagtcat cgccaggccg      1560
     ctcgccggcg ccctgccact gacggatatc atcgtcgatc accgccatgc gtcgcaattg      1620
     cgccaactcc tgttgctgga gccggcactc gaacgtcagc gactgcgcaa gacctgcctg      1680
     atcagccccg aagagcgcag cagccacccg gtgaaccgga tgggcggcta cgaggcctgg      1740
     ctgatccgcc ccttgcggga gaaatccctg gtggaggtgc tgctcggccg catgacgggc      1800
     atcgaaaagc gcgatggaat caacgacaac aggccaatcc tcagggcgga gccgcggaag      1860
     gctgccgcgg tttcaccgga tcgccgccgg gtgctgctcg ccgaggacga tccggtgaat      1920
     gccttggtgc tgcggaagat gctggagagg gccggacacg gcgtcgatca tgtcggcgac      1980
     ttcgccgcgc tcgaagctgc gttgcaaggg agggctgcac ccgggctcat cgtgacggac      2040
     ttcaatatgc cgggcggcga cgggcttgcc ctgcttcggc gccttcgcgg ggtcgaagca      2100
     gccggaaaag ggaaccgggt gcctgtggtc gttctgacct cggatgtccg aagcgatctg      2160
     catcggctgc tgcttgcggc cggtgcggac gccgtcctta caaagccggc cgaaccggag      2220
     cggttcctcg cagaagtcgc gcggctgctc gatgccgggc aggcgtag                   2268
//

If you have problems or comments...

PBIL Back to PBIL home page