(data stored in ACNUC7421 zone)

EMBL: CP001389.PE281

CP001389.PE281       Location/Qualifiers
FT   CDS_pept        325638..326600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02870"
FT                   /product="flagellin protein FlaD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24085"
FT                   /db_xref="GOA:C3MG34"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG34"
FT                   /protein_id="ACP24085.1"
FT                   /translation="MTSIMTNAAAMAALQTLRSINRNLDETQSRVSSGYRVETAADNAA
FT                   YWSIATTMRSDNAALSTVQDALGLGAAKVDTAYAALDTVIDLMSEVKAKLVAAREPGVD
FT                   KTKIDKELAQLKEQLVSAAQSASFSGENWLYNDAATAVGTKSIVASFNRSADGSVSVTT
FT                   LDYDTSGSILVDVQDASRGLLTMAVDADTLVSAPTGSAREYYLIDAGSPPAGTEIALSE
FT                   TTTDEELDDMISVVDDLVSQLTNSAATLGAITSRIEMQENFVANLMDVIDKGVGRLVDA
FT                   DMNEESTRLKALQTQQQLGIQSLSIANTNSENILRLFQE"
     atgaccagca tcatgaccaa cgctgccgcc atggcggcat tgcagaccct gcgttcaatc        60
     aacagaaatc tggacgagac ccagagccgc gtgtcctccg gctaccgcgt cgagaccgcc       120
     gcggacaatg ccgcctattg gtcgatcgcg acgacgatgc ggtcggacaa tgccgcgctt       180
     tcgaccgtgc aggatgcgct tggcctcggt gcggccaagg tcgataccgc ctatgccgcc       240
     ctggacacgg tcatcgacct gatgagcgag gtcaaggcga agctggtggc ggcgcgcgag       300
     cctggcgtcg acaagaccaa gatcgacaag gagcttgcgc agctcaagga acagctggtg       360
     tcggcggctc agtccgcatc cttctcgggt gagaactggc tctacaacga cgcagccacc       420
     gcggtcggca ccaagtccat cgtggcctcc ttcaatcgca gcgccgacgg cagcgtctcc       480
     gtaacgacgc tcgattatga tacgtcgggc tccattctcg tggacgtcca ggacgcgagc       540
     cgcggcttgc tgacgatggc ggtggatgcg gacacgctcg tctcggctcc gacgggatcg       600
     gcgcgtgaat actacctgat cgacgccggc agcccgccgg ccggcacgga aattgcgctt       660
     tccgaaacga ccactgacga agagctggac gacatgatca gtgtcgtcga tgacctcgtc       720
     agccagttga cgaattcggc cgcgaccctt ggtgcgatca ccagccgcat cgaaatgcag       780
     gaaaacttcg tcgccaacct gatggatgtg atcgacaagg gcgtcggccg tctcgtcgac       840
     gcggacatga acgaggagtc gacgcggttg aaggcgctgc agacccagca gcagctcggc       900
     atccagtcgc tgtcgatcgc caataccaac tccgaaaaca tcctgagact gttccaggag       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page