(data stored in ACNUC7421 zone)

EMBL: CP001389.PE282

CP001389.PE282       Location/Qualifiers
FT   CDS_pept        326975..327628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24086"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG35"
FT                   /protein_id="ACP24086.1"
FT                   /translation="MSASLSRYLKDFSAPKIELTRMPPKYFPDLEADFPTEDRSAQRPT
FT                   MPEIDVDAERREAFAQGRAEAAAELAFEHQRELAELKARHAEELDAVRHRLAEETASKL
FT                   AAGFDQITERLALALGDQTARVLAPVLEAALLKRAIEDLATMIRQGVGAGEGLTITVKG
FT                   SPVLFEALKQHLDDDTLLFRHVVADDIDLTVELGETVLVTRMAAWSDTVRKVLA"
     atgagtgcgt cgctctcccg ctatctcaag gatttcagcg cgccgaagat cgaactcacg        60
     cggatgccgc caaaatattt tccggacctc gaggccgact ttcccaccga agaccgatcc       120
     gcccaaaggc cgaccatgcc agagatcgac gtcgatgccg agcggcgcga agcctttgcg       180
     caggggcgcg cggaagccgc ggccgaactg gccttcgagc accagcggga gctcgccgaa       240
     ctcaaggcgc gccacgccga ggaactcgac gccgtgaggc atcgcctggc ggaagaaacc       300
     gcttcgaaac tcgctgccgg cttcgatcag atcaccgagc ggctggcgct ggcccttggc       360
     gaccagaccg cccgcgtgct tgccccggtc ttggaggcgg cgctgctcaa gcgcgccatt       420
     gaagacctgg cgacgatgat caggcagggc gtcggcgcgg gagaggggct taccatcacc       480
     gtcaagggat cgcctgtgct cttcgaagcg ctgaaacagc atctggacga cgacacgctg       540
     ctgttccggc acgtggttgc cgacgacatc gatctcacgg ttgagttggg cgaaacggtc       600
     ctggtgaccc gaatggcggc ctggtccgat accgtccgga aggttctggc atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page