(data stored in ACNUC7421 zone)

EMBL: CP001389.PE286

CP001389.PE286       Location/Qualifiers
FT   CDS_pept        331533..332096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02920"
FT                   /product="putative lytic transglycosylase-like protein,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24090"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG39"
FT                   /protein_id="ACP24090.1"
FT                   /translation="MERTMRLLALGTLALVTSTCSALASAGICEREIASAAAKYGIPTG
FT                   ILYSVGLTETGRKGSLQPYAMNIEGKAYFGTSVQDVLGRFGAARAQGAKLIDLGCMQIN
FT                   YHFHGEHFSSPEEMLDPRRNVDYAARFLSNLRARHESWTMAVARYHAGPNNDPAQKKYV
FT                   CRVIANLVATGYGKWTPNAAQFCQ"
     atggaacgga cgatgcggct gctggcgttg ggcactctcg cactggtgac gtctacatgt        60
     agcgccctgg cgagcgccgg catctgcgaa cgcgagatcg cgtcggctgc ggccaagtac       120
     gggatcccga ccggcattct ctactccgtc ggcctgacgg agaccggccg caagggatcg       180
     ctgcagccct acgcgatgaa tatcgagggc aaggcctatt tcggcaccag cgttcaggat       240
     gtccttggcc gtttcggagc cgcacgggcg caaggggcga agctcatcga tctcggctgc       300
     atgcagatca attatcactt tcacggcgag catttcagtt ctccggagga aatgcttgat       360
     ccccggcgga atgtcgacta tgccgcgcgc ttcctctcca atctgcgcgc caggcacgag       420
     agctggacga tggcggttgc tcgctatcat gccgggccga acaacgatcc ggcgcaaaag       480
     aaatatgtct gccgggtcat cgccaatctc gtcgcgacag gctacggcaa gtggacgccg       540
     aacgcggcgc agttttgcca ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page