(data stored in ACNUC7421 zone)

EMBL: CP001389.PE29

CP001389.PE29        Location/Qualifiers
FT   CDS_pept        26505..27395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23833"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ6"
FT                   /protein_id="ACP23833.1"
FT                   /translation="MTIDLLDSTSVVDTSQVRSRKTIAAPATDVLGRIANLETRLARTA
FT                   AEIDAAQAVRYRVFVEEMKAQVTPEAERRKRDVDGWDAICDHLLVLDTSIEGDAEEQIV
FT                   GTYRLLRQEVAARAGGFYSASEFAIDDLLARHPDKRFMELGRSCVLPEYRTKRTVELLW
FT                   QGNWAYALKHGIDAMFGCGSLPGVVPEEHALALSFLHHNLLARDQWAVAARPELYRTMD
FT                   LMPPEAINPKKALAALPPLIKGYMRLGAMVGDGAVVDHAFRTTDVLIVLPISNISGRYL
FT                   NYYGADAGRFSSSVS"
     atgacgatcg accttctgga ttcgacgagc gtggttgaca cttcacaggt tcgcagccgc        60
     aagaccattg cggcaccggc aaccgatgtt ctcggccgta tcgccaatct cgaaacgcgg       120
     cttgcccgta ctgccgcgga gatcgacgcg gcgcaggccg tgcgttaccg cgtcttcgtc       180
     gaggagatga aggcgcaggt gacgcccgag gccgaacggc gcaagcgcga tgtcgacggc       240
     tgggacgcga tttgcgacca tctgctcgtc ctcgacacct cgatcgaagg ggacgccgag       300
     gagcagatcg tcggcaccta ccgcctgctg cgccaggagg tcgccgcgcg ggcgggcggc       360
     ttctattcgg cttccgaatt tgccatcgac gatcttctcg cccgtcatcc ggacaagcgc       420
     ttcatggaac tcggccgctc ctgcgtgctg ccggaatacc ggaccaagcg caccgtggaa       480
     ctgctctggc agggcaattg ggcctatgcg ctgaagcatg gcatcgatgc catgttcggc       540
     tgcggctccc ttccgggggt cgttcccgag gagcatgcgc tggcgctttc ctttctccac       600
     cacaacctgc tcgcccgcga tcaatgggcg gtcgccgccc ggccggaact ctatcgcacg       660
     atggatctca tgccgcccga agcgatcaat ccgaagaagg cgcttgcagc gctgccgccg       720
     ctcatcaagg gctatatgcg gctcggtgcg atggtcggcg acggtgccgt cgtcgatcac       780
     gctttccgga cgacggacgt gctgatcgtt ctgccgatca gcaatatctc cggccgctat       840
     ctcaactact acggcgccga cgccggccgc ttttcttcgt ccgtctcctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page