(data stored in ACNUC7421 zone)

EMBL: CP001389.PE297

CP001389.PE297       Location/Qualifiers
FT   CDS_pept        341514..341927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24101"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG50"
FT                   /protein_id="ACP24101.1"
FT                   /translation="MKSRSKKLKRLVDVQRHLERMAESELAETTRQRGVLSETIDVVVD
FT                   AMGSAHPMHRVFSGHYAAQLGRLVQKDQMLLGIQQVHEARMLKERAKGDRLQESMEEAR
FT                   MTEDREADDNQVLDLIDQHVAGYAPASGKLEGR"
     atgaaatcgc gatcgaaaaa attgaagcgc ctggtcgacg tacagcggca tctcgagcgg        60
     atggccgaaa gcgagcttgc cgagacgacg cgccagcgcg gcgtactctc cgagacgatc       120
     gacgttgtcg tcgatgccat gggctcggcc catcccatgc atcgcgtctt ctcgggccat       180
     tatgcggcgc agctcgggcg gctggtgcag aaggaccaga tgctgctcgg catccagcag       240
     gtgcacgagg cacgcatgct gaaggagcgt gcgaagggcg accggctgca agagagcatg       300
     gaagaggcac gcatgacgga agaccgcgag gctgacgaca atcaggtgct cgacctcatc       360
     gatcagcacg ttgccggtta cgcgccagct tccggtaagc ttgaggggcg atag             414
//

If you have problems or comments...

PBIL Back to PBIL home page