(data stored in ACNUC7421 zone)

EMBL: CP001389.PE298

CP001389.PE298       Location/Qualifiers
FT   CDS_pept        342017..342562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24102"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI7"
FT                   /protein_id="ACP24102.1"
FT                   /translation="MAISPPSDLVLDVVRAADPAEVQEAQTRLKANRAAFQATSLAENG
FT                   NGFAAAVSVLNSSEGSTGLGDVSNRVEPKKVPETYRKFEAMVLQNFVKSMLPSESESVF
FT                   GKGTSGEVWKGMMAEQIANVLADGGGIGIADRMAGSDTADRASARLDDDTSNIAAGMVH
FT                   EYERKAGFFTTDDKKNQA"
     atggctattt ccccgcccag cgatctggtg ctggacgtcg tccgcgcggc cgatccggcg        60
     gaagttcagg aggcgcagac gcggctcaag gccaatcggg ccgcctttca ggcgacgagc       120
     cttgcggaaa acggcaatgg cttcgctgcg gcggtttcgg tgctgaattc ctcggaagga       180
     tcaacgggcc tcggagacgt cagcaaccgc gtcgaaccga agaaggtgcc ggagacctat       240
     cgcaagttcg aggcgatggt gctgcagaac ttcgtcaagt cgatgctgcc gagcgaaagc       300
     gagagcgtct tcggcaaggg tacgtccggc gaggtctgga agggcatgat ggcggagcag       360
     attgccaacg tgctggccga tggcggcggc atcggcattg ccgaccggat ggccggcagc       420
     gacacggccg atcgcgccag cgcgcggctt gacgacgata ccagcaacat cgccgccggc       480
     atggttcacg aatacgagcg caaggccggg ttcttcacga ccgacgacaa gaagaaccag       540
     gcatag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page