(data stored in ACNUC7421 zone)

EMBL: CP001389.PE299

CP001389.PE299       Location/Qualifiers
FT   CDS_pept        342635..343003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24103"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI8"
FT                   /protein_id="ACP24103.1"
FT                   /translation="MEAVASHDLRIQNVLGRLEMIIDNENSRIGVDPKFDIKTSNAHKS
FT                   RCLYELTMLHRDTAAGEISPSFASQTRHLRQKLKLNAQKVEAHLEAVRSVVDLLKTAAQ
FT                   DADADGIYTEAQFRYSDF"
     atggaagctg tggcatccca cgatctgcgg atacagaacg ttctcggccg gttggagatg        60
     atcatcgaca acgagaacag ccgcatcggc gtggacccga aattcgacat caagacgtcg       120
     aacgcacata agagccgctg cctctacgag ctgacgatgt tgcatcgcga caccgcagcc       180
     ggtgaaattt cgccgtcctt cgcctcgcag acgcgccacc tccggcagaa gctgaaactc       240
     aacgcccaga aggtcgaagc gcatctcgaa gccgtgcgtt cggtcgtcga tcttctgaag       300
     accgctgcgc aggacgccga cgccgacggc atctacaccg aagcgcaatt ccgctatagc       360
     gatttctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page