(data stored in ACNUC7421 zone)

EMBL: CP001389.PE30

CP001389.PE30        Location/Qualifiers
FT   CDS_pept        complement(27793..30078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00300"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23834"
FT                   /db_xref="GOA:C3MEZ7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ7"
FT                   /protein_id="ACP23834.1"
FT                   /translation="MPATDKTDRTMTSVTAQEALDFHSQGRPGKLEISPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAEDPATAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   SVLFKRFADVDSIDLEVDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFIIEQRLREV
FT                   MDIPVFHDDQHGTAIIAAAGLINALALTGRDFKTTKLVCNGAGAAAIACIELIKAMGFN
FT                   PENIILCDTKGVIFQGRTEGMNQWKSAHAVKTDRRTLAEAVEGSDVFFGLSAKGALSPE
FT                   MVRSMAARPIIFAMANPDPEITPEEVAQIRDDAIVATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAAEALASLAKEDVPDDVAAAYQGNRPRFGPQYIIPVPFDPRLIS
FT                   AIPMAVAKAAMETGVAQKPIADLNAYGQQLSARRDPIASTLQRIFERVRRQPKRIVFAE
FT                   GEEVQMMRSAIAYANQQLGTAILLGREEQMRETAEREGIDLDRPGIQIVNARLSKRVSA
FT                   YTDFLYARLQRKGYLFRDVQRLINNDRNHFAASMVALGDADGMVTGLTRNYSTALEDVR
FT                   RCIDAKPGHRVIGVSIALCRGRTVLVADTAVHDMPSAEELADIAEEAAGLAKRLGYMPR
FT                   VAMLAYSTFGHPSGERSERVREAVKILDRRRVDFEYDGEMAADVALNHRVLEQYPFCRL
FT                   SGTANVLVMPAFHSASISTKMLQELGGSTVIGPLLVGFDKSVQITSMSAKDSDIVNLAA
FT                   IAAYNAGT"
     atgccggcta ccgacaagac cgaccgcacg atgacgagcg tcaccgccca ggaggcgctc        60
     gacttccatt cccagggtcg tcccggaaag ctggagattt caccgacgaa gccgatggcg       120
     acgcagcgcg acctgtcgct cgcctattcg ccgggcgtcg ccgtgcccgt caaggcaatc       180
     gccgaggatc cggcgacggc ctacgactat acggcgcgcg gcaacatggt ggcggtgatt       240
     tcgaacggca cggcgatcct cggcctcggc aatttgggcg cgcttgcctc gaagccggtg       300
     atggagggca agtccgtgct cttcaagcgc tttgccgatg tcgattcgat cgatctcgaa       360
     gtcgacaccg agaatgtcga cgaattcatc aactgcgtgc gcttcctcgg cccgtccttc       420
     ggcggcatca atctcgagga tatcaaggcg ccggactgtt tcatcatcga gcagcggctg       480
     cgcgaggtca tggacattcc ggtgttccat gacgaccagc acggcaccgc gatcatcgcc       540
     gccgccggcc tcatcaatgc gctggccctg accggccgcg acttcaagac gacgaagctc       600
     gtctgcaacg gcgcgggtgc cgcggccatc gcctgcatcg agctcatcaa ggcgatgggc       660
     ttcaacccgg aaaacatcat cctctgcgac accaaggggg tgatcttcca gggccgcacc       720
     gagggcatga accagtggaa gtcggcgcac gccgtcaaga ccgaccgccg gacgctggcc       780
     gaggcggtcg agggttccga cgtgttcttc ggcctttcgg ccaagggcgc cctctcgccc       840
     gagatggtgc gttcgatggc ggcaaggccg atcatcttcg ccatggccaa tccggatccg       900
     gaaatcaccc ccgaagaggt ggcccagatc cgcgacgatg cgatcgtcgc gaccgggcgc       960
     tccgactatc cgaaccaggt caacaatgtt ctcggctttc cctacatctt ccgcggcgcg      1020
     ctcgatgtgc gcgcctcgac gatcaacgac gcgatgaaga ttgccgcggc ggaagcgctg      1080
     gcgagcctcg ccaaggagga cgtgccggac gacgtcgccg ccgcctatca gggcaaccgg      1140
     ccgcgcttcg ggccgcaata catcattcct gtacccttcg atccgcgcct gatctcggcg      1200
     atcccgatgg ccgtcgccaa ggccgccatg gagaccgggg tggcgcaaaa gccgatcgcg      1260
     gatctcaatg cctatgggca gcagctttcc gcccggcgcg acccgatcgc ctcgacgctg      1320
     cagcggattt tcgagcgcgt ccgccgtcag ccgaagcgca tcgtcttcgc cgagggcgag      1380
     gaagtgcaga tgatgcgctc ggccattgcc tatgcgaacc agcagctcgg cacggcgatc      1440
     ctgctggggc gcgaggagca gatgcgcgaa accgccgaac gggagggcat cgacctcgat      1500
     cggcccggca tccagatcgt caatgcgcgt ctgtcgaaac gcgtcagcgc ctataccgac      1560
     ttcctctatg cccggctgca gcgcaagggt tatctcttcc gcgacgtgca gcggctgatc      1620
     aacaacgacc gcaaccactt cgccgcctcc atggtcgcgc tcggcgatgc cgacggcatg      1680
     gttaccggtc tgacgcgcaa ctactcaacc gcgctcgagg acgtccgccg ctgtatcgac      1740
     gcaaagcccg gccaccgggt gatcggcgta tcgatcgcgc tctgccgcgg ccgtaccgtg      1800
     ctcgtcgccg acaccgcggt tcacgacatg ccctctgccg aggagctggc cgatatcgcc      1860
     gaggaggccg ccgggctcgc caagcggctc ggctacatgc cccgcgtcgc catgcttgcc      1920
     tactcgacat tcggccatcc gtcgggcgag cgctccgagc gggtccgcga ggcggtgaag      1980
     attctcgacc ggcgccgtgt cgatttcgaa tatgacggcg aaatggccgc cgacgtggcg      2040
     ctcaatcatc gggtgctcga gcaatatccg ttctgccggc tttccggcac cgccaacgtg      2100
     ttggtgatgc ctgccttcca ctcggcctcg atctccacca agatgctcca ggaactgggc      2160
     ggctcgaccg tcatcggccc gctgctcgtc ggcttcgaca agtcggtgca gatcacctcg      2220
     atgtcggcca aggattccga catcgtcaac ctggcggcaa tcgccgccta caatgccggg      2280
     acgtga                                                                 2286
//

If you have problems or comments...

PBIL Back to PBIL home page