(data stored in ACNUC7421 zone)

EMBL: CP001389.PE300

CP001389.PE300       Location/Qualifiers
FT   CDS_pept        343003..343569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24104"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI9"
FT                   /protein_id="ACP24104.1"
FT                   /translation="MLKLVLTGVWVCAVTLGSVYFSMQYASAPIVSDAEADRRASEEYV
FT                   PGEIITVPVIEEGAVQGYFLAKLSFSATREGIAKLHAPLRQVVTDELYDMLVGSRFVDV
FT                   ADTGTFDLPSFKVAVKDGLNKKLGGEVITEVLVEQLEYLGKDDMKRVANGNNRPYQEPV
FT                   PVVDKHGNVASDKIPEGAVKASSGH"
     atgctgaagc tcgttctcac cggggtctgg gtctgcgcag tgacgcttgg atccgtttat        60
     ttctcgatgc agtacgcctc ggcgccgatc gtctcggacg cggaggctga taggcgcgca       120
     tcggaggaat atgtgccggg agagatcatt accgttccag tgatcgagga aggagcggtt       180
     caaggctact tcctggcgaa actgtccttc tcggcgacgc gggaagggat agcgaagctt       240
     cacgcgccgc ttcgccaggt cgtgaccgac gagctctatg acatgctcgt cggctcccgg       300
     ttcgtcgatg tcgccgacac cggcacgttc gacctgccga gcttcaaggt cgcggtcaag       360
     gacggcctca acaagaaact cggcggcgag gtcattaccg aagtcctggt cgaacagctc       420
     gaatatctgg gcaaggacga catgaaacgc gtggcgaacg gcaacaacag gccctatcag       480
     gagccggttc cagtggtcga caagcatggc aacgtcgcct ccgacaagat ccccgaaggt       540
     gccgtgaagg cgtcaagcgg ccattga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page