(data stored in ACNUC7421 zone)

EMBL: CP001389.PE304

CP001389.PE304       Location/Qualifiers
FT   CDS_pept        347293..348651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03100"
FT                   /product="predicted alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24108"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ3"
FT                   /protein_id="ACP24108.1"
FT                   /translation="MKRSLLIGVAALALLAGAASAADLKFKPGEDSKFNWGSFEEFKKG
FT                   HDLKGQTLTIFGPWRGEDEALFKSVFAYFVEATGVEVKYSSSENYEQQIVIDTQAGSPP
FT                   DVAILPQPGLIADLAAKGLLTPLGDETKQWLLDNYAAGQSWVDLSTYSGKDGAAALYAF
FT                   PYKIDVKSLVWYVPENFEDAGYEVPKTMEELKALTEKIAADGEKPWCIGLGSGGATGWP
FT                   ATDWVEDLMLRTQSPEVYDKWTKNEIPFTDPAVTGALDEFGWFARNDKFVDGGAAAVAS
FT                   TDFRDSPKGLFASPPKCYLHHQASFIPSFFPEGTVVGEDADFFYMPPYESKKELGNPVL
FT                   GAGTLAMITKDTPAARAFIEFLKTPIAHEVWMAQTSFLTPYKSVNVEVYGNPPLKKQGE
FT                   ILLNATTFRFDGSDLMPGKIGAGALWTGMVDYVGGKSSADVAADVQKAWDAIK"
     gtgaagagat cactgctgat tggcgtggct gcgctcgctc tgcttgcagg ggccgccagc        60
     gctgcagacc tgaagttcaa gccgggcgaa gattcgaagt tcaattgggg aagcttcgag       120
     gagttcaaga agggccacga cctgaaaggc cagacgctga cgatcttcgg tccctggcgc       180
     ggcgaggacg aggctctgtt caagagcgtg tttgcctatt tcgtcgaggc gacgggggtc       240
     gaggtcaaat attcctcctc ggagaactat gagcagcaga tcgtcatcga cacccaggca       300
     ggcagcccac ccgacgttgc gatccttccg caaccgggtc tgattgccga cctggctgcg       360
     aagggcctcc tgacgccgct cggcgacgaa accaagcaat ggctgctcga caactatgcc       420
     gccggccagt cctgggtgga tctctccacc tatagcggca aggacggtgc cgcggcgcta       480
     tacgccttcc cctacaagat cgacgtcaag tcgctcgtct ggtacgtccc ggaaaacttc       540
     gaggacgccg gctacgaagt tcccaagacc atggaagagc tgaaggctct gaccgagaag       600
     attgccgccg acggcgagaa gccctggtgc atcggtctcg gctcgggcgg cgcgaccggc       660
     tggccggcga cggattgggt cgaagacctg atgctgcgca cgcagtcacc cgaagtttac       720
     gacaagtgga ccaagaacga aattcccttc acggatcccg cagtgaccgg cgcgctcgac       780
     gagttcggct ggttcgcacg gaacgacaag ttcgtagacg gcggcgcggc ggcggttgcc       840
     tccaccgatt tccgcgacag cccgaaaggt ctcttcgcct cgccgccgaa gtgctatctg       900
     caccatcagg cctccttcat cccctccttc ttccctgaag gcacggtggt cggcgaggat       960
     gccgacttct tctacatgcc gccctacgag agcaagaagg aacttggcaa tccggtgctc      1020
     ggcgccggca cgctcgcgat gatcaccaag gatacgccgg ccgcgcgcgc cttcatcgag      1080
     ttcctgaaga cgccgatcgc gcacgaggtc tggatggcgc agacgagctt cctgacgccc      1140
     tataagagcg tcaatgtcga agtctacggc aacccgccgc tgaagaagca gggcgagatc      1200
     ctgctcaatg ccaccacctt ccgcttcgac ggttcggacc tgatgcccgg caagatcggc      1260
     gcgggcgcac tctggaccgg catggtcgac tatgtcgggg gcaagtcctc cgccgacgtt      1320
     gcggccgatg tccagaaggc ctgggacgcc atcaagtaa                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page