(data stored in ACNUC7421 zone)

EMBL: CP001389.PE305

CP001389.PE305       Location/Qualifiers
FT   CDS_pept        348902..349909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03110"
FT                   /product="predicted alpha-glucoside transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24109"
FT                   /db_xref="GOA:C3MGJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ4"
FT                   /protein_id="ACP24109.1"
FT                   /translation="MQLLAAILTMIVGVLACAAYFWATNFILDRIFPSKGLSGVTASRN
FT                   LRITNAIRPWLFLAPALFALTIYLIYPVVQSVWLSFHDRGGQSFVGARNYSWMINDGEF
FT                   RQSIFNNFLWLLVVPALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVIWKF
FT                   IYDYRAEGSEQIGLLNAIVVAFGGAPEAWITLPFWNNFFLMVILIWIQTGFAMVILSAA
FT                   LRGIPEETIEAAVIDGANGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVLAMTNG
FT                   QWQSQVLANLMFDWMFRGGGDFGRGASIAVVIMVLVIPIMIWNIRNATKESGGH"
     atgcagctgc tcgctgccat tctgacgatg atagttggcg tcctggcctg cgcggcctat        60
     ttctgggcga ccaatttcat tcttgatcgg atttttccgt cgaaggggct gtcgggtgtc       120
     accgcctccc gcaatctgcg aatcaccaat gccatccggc cgtggctgtt cctggcgccg       180
     gctctgttcg cgttgacaat ctatctcatc tatccggtcg tccaatccgt gtggctcagc       240
     ttccacgaca ggggcggcca gagtttcgtc ggcgcgcgca actacagttg gatgatcaac       300
     gacggtgaat tccgccagtc gatcttcaac aacttcctct ggctgctggt cgttcctgct       360
     ctctcgacct tcttcggcct gatcatcgcg gcgctgaccg atcgcatctg gtggggcaat       420
     atcgccaaga cgctgatctt catgccgatg gcgatctcct tcgtcggcgc cgcggtcatc       480
     tggaaattca tctatgacta tcgtgccgaa ggctccgagc agattggcct gctgaacgcg       540
     atcgtcgtcg ccttcggcgg cgcgcctgag gcctggatca cgctaccctt ctggaacaac       600
     ttcttcctga tggtcatcct catctggatc cagacgggct ttgccatggt catcctctcg       660
     gcggcgctgc gcggcattcc ggaggaaacg atcgaggcgg cggtgatcga cggtgccaat       720
     ggctggcaga ttttcttcaa gatcatggtg ccgcagatct ggggcacgat cgcggtcgtc       780
     tggacgacca tcaccatcct tgtcctgaag gtcttcgata tcgtgctggc gatgacgaac       840
     ggccagtggc agagccaggt gctcgccaac ctgatgttcg actggatgtt ccgcggcggc       900
     ggtgacttcg gccgcggcgc atcgatcgcc gtcgtcatca tggtgctcgt cattccgatc       960
     atgatctgga acatccgcaa cgcaaccaag gaatcggggg gccactga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page