(data stored in ACNUC7421 zone)

EMBL: CP001389.PE306

CP001389.PE306       Location/Qualifiers
FT   CDS_pept        349911..351059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03120"
FT                   /product="predicted alpha-glucoside ABC transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24110"
FT                   /db_xref="GOA:C3MGJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ5"
FT                   /protein_id="ACP24110.1"
FT                   /translation="MNPSTRSPLTWAVHLSVLLLVVLWTMPTAGLLISSLRDKDQLAVS
FT                   GWWTALATSSRNDVARAPSADSQVERDGKFVISGNLLEGQGGGQISAFGFSSREPGKFK
FT                   AGETAELNDGERLTVQADGSFEIVSDTKMEGSRGQRIFYTAATPPRFTIDNYIEVLSAA
FT                   GIGTSFLNSLTVAIPSTVIPILIAAFAAYALAWMPFPGRAILLAVVVGLLVVPLQMSLI
FT                   PLLQLYNGVGAFFGVPAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGA
FT                   SDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGEDSLVLTGRLVNLLGS
FT                   RGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKGG"
     atgaatccgt cgacgcgttc tccgctcacc tgggccgtcc atctttcggt cctgcttttg        60
     gtcgttctct ggaccatgcc gaccgccggg ctcctgatct cgtcgctgcg cgacaaggac       120
     caactcgccg tttccggctg gtggacggcg ctggccacct cgtcgcgcaa cgatgtggcg       180
     cgtgcccctt cggccgacag ccaggtcgaa cgggacggca agttcgtgat ctccggcaac       240
     ctgctcgagg ggcagggtgg cggtcagatt tccgccttcg gcttctccag ccgtgagccg       300
     gggaagttca aggccggcga gacggccgaa ctcaatgacg gcgagaggct gacggtgcag       360
     gccgacggca gcttcgagat cgtctcggac acaaagatgg aaggatcgcg cggccagcgc       420
     atcttctata ccgccgccac gccaccgcgc ttcaccatcg ataactacat cgaagtgctg       480
     agcgcggccg gcatcggcac gtcgttcctc aattcgctga cggtcgcgat tccctcgacg       540
     gtgattccga tcctgattgc ggcttttgca gcctatgcac ttgcctggat gcctttcccc       600
     ggccgcgcga tcctgctcgc cgtcgtcgtc ggcctgcttg tcgtgccgct gcagatgtcg       660
     cttatcccgc tgctgcagct ttataacggt gtcggggctt tcttcggcgt cccggccaag       720
     acttatatgg gcatttggct cgcccatacc ggcttcggac tgccgctggc gatctatctc       780
     ctgcgcaact acatggccgg cctgccgcgc gagatcatgg agtctgcccg tgtcgacggc       840
     gccagcgatt tcgatatctt cgtcaagata atattgccgc tgtcgttccc ggcgctcgcc       900
     tccttcgcca tcttccagtt tctctggact tggaacgatc tgctcgtagc catcgtcttc       960
     ctcggcgcgg gcgaggattc gctggtgctg accggccgcc tggtcaacct tctcggctca      1020
     cgcggcggca attgggaaat tctcaccgcc tccgccttca taaccatcgt cgttccgctg      1080
     atcgtcttct tcgcgctgca acgctacctc gtgcgtggcc tgttggcggg atcggtcaag      1140
     ggcggctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page