(data stored in ACNUC7421 zone)

EMBL: CP001389.PE308

CP001389.PE308       Location/Qualifiers
FT   CDS_pept        352762..353850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03140"
FT                   /product="alpha-glucoside ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24112"
FT                   /db_xref="GOA:C3MGJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ7"
FT                   /protein_id="ACP24112.1"
FT                   /translation="MTGLLLKDIRKSYGAVDVIHGINLDIKQGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEEITGGDMFIDGQRVNEVPPSQRGIAMVFQSYALYPHMTVYDNMAFGMRIAK
FT                   ETKEEIDRRVRSAADILQLTKYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSN
FT                   LDAALRVATRIEIAKLSERMADTTMIYVTHDQVEAMTLADRIVVLSLGHIEQVGAPLEL
FT                   YERPANLFVARFIGSPAMNVFPSTITATGAQTTVTLAGGKSVTLDIPTNASEAGKKASF
FT                   GVRPEDLQVTDGQDFLFEGTISIVEALGEVTLLYIEGLVENEPIIAKIPGILKVGRGDK
FT                   VRFTADKAKLHLFDADGRSYRA"
     atgacgggtc tgctgctaaa agacatccgc aagtcctacg gggcggtcga tgtcattcac        60
     ggtatcaatc tcgacatcaa gcagggtgag ttcgtcgtct tcgtcgggcc gtccggttgc       120
     gggaagtcga cgctgctgag gatgatcgcc gggcttgagg agatcaccgg cggcgacatg       180
     ttcatcgacg gccagcgagt caacgaggtg ccgccgtcgc agcgcggcat tgccatggtg       240
     ttccagtcct atgcgctcta cccgcatatg accgtctacg acaacatggc cttcggcatg       300
     cggatcgcca aggaaacgaa ggaggagatc gatcgacgcg tccgctcggc cgcagacatc       360
     ctccagctca ccaaatacct cgatcgcctt ccgaaggcgc tctccggcgg gcagcgccag       420
     cgtgtcgcga tcggtcgggc gatctgccgc aacccgaagg tcttcctctt cgacgagccg       480
     ctttccaacc ttgacgcggc gctgcgcgtc gccacccgca tcgagatcgc caagctcagc       540
     gagcggatgg ccgatacgac gatgatctat gtcacccacg accaggtgga ggcgatgacg       600
     ctcgccgacc gcatcgtggt tctgtctttg ggtcacatcg agcaggtcgg cgcgccgctc       660
     gagctttacg agcggccggc aaatctcttc gtcgcgcgct tcatcggctc gccggccatg       720
     aacgtcttcc cctcgacgat cacggcgacc ggcgcgcaga cgacggtgac gctggcgggc       780
     ggcaagtccg tgacgctcga catcccgacg aacgcgtccg aagccggcaa gaaggcgagc       840
     ttcggcgtgc gtccggagga cctgcaggtg acggacggcc aggacttcct cttcgagggc       900
     acgatctcga tcgtcgaggc gctcggcgag gtgacgcttc tctacatcga aggcctcgtc       960
     gagaacgagc cgatcatcgc caagatcccc ggcatcctca aggtcgggcg cggcgacaag      1020
     gtgcgcttta ccgccgataa ggcgaagcta catctcttcg acgccgacgg gcgcagctat      1080
     cgcgcttaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page